KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_0156Help
Entry
DABAL43B_0156     CDS       T04748                                 

Gene name
phhB1
Definition
(GenBank) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00790  Folate biosynthesis
psyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DABAL43B_0156 (phhB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psyc04147]
    DABAL43B_0156 (phhB1)
Enzymes [BR:psyc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     DABAL43B_0156 (phhB1)
Exosome [BR:psyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DABAL43B_0156 (phhB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Sun2_CC2 IF-2
Motif
Other DBs
NCBI-ProteinID: SLJ83378
UniProt: A0A1U6GIR3
Position
I:complement(180113..180406)
Genome map
AA seq 97 aa AA seqDB search
MSSLSDKQVDLQLDELPGWQRDGHAIVKTYHFSDFIEAMSFMNQAAFHAEALEHHPEWRN
TYNVVEVRLTTGDTGGITSHDIRLAKRMEHIVQPKRL
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttatctgacaaacaagtagatctgcagctagacgaactgcccggctggcaa
cgggatggtcatgctatcgtaaaaacttaccactttagcgattttatcgaagccatgagt
tttatgaatcaagcagcttttcatgctgaagcacttgagcatcatcctgaatggcgcaat
acatacaacgtagtagaggtacgcctgactactggagatacgggcggcatcaccagtcat
gatattcgtttagcaaaacgaatggagcatattgtccaacctaagcgcttataa

DBGET integrated database retrieval system