KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_0367Help
Entry
DABAL43B_0367     CDS       T04748                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00020  Citrate cycle (TCA cycle)
psyc00480  Glutathione metabolism
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01200  Carbon metabolism
psyc01210  2-Oxocarboxylic acid metabolism
psyc01230  Biosynthesis of amino acids
Module
psyc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DABAL43B_0367 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DABAL43B_0367 (icd)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DABAL43B_0367 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: SLJ83582
UniProt: A0A1U6GJ86
Position
I:423646..424905
Genome map
AA seq 419 aa AA seqDB search
MSYNKVIVPRDGEKITVNADLSFNVPNHPIIPFIEGDGIGVDITPVMIKVVDAAVEKAYK
GKKSIVWMETYCGEKAAKIYDGEFMPEETLEILRDYVISIKGPLTTPVGGGMRSLNVALR
QELDLYVCQRPVRWFEGVPSPVHHPELTDMIIFRENSEDIYAGIEWKAGSEDAIKVIKFL
KEEMGVTKIRFPENCGIGIKPVSKEGTQRLVRKAIQHAIDNDLPSVTLVHKGNIMKYTEG
AFKEWGYELAAERFGAQLLDGGPWMTMKNPKTGHEIIIKDVIADAFLQQILMRPADYSVI
ATLNLNGDYISDALAAEVGGIGIAPGANKGGAIAVYEATHGTAPKYAGQNKVNPGSLILS
AEMMLRDMGWLEAADLVIKGIQGAIKNKTVTYDFERLMPDAILLSTSEFGKAIIKHMNA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataacaaggttatcgtaccaagagacggcgaaaaaataacggtaaatgcggat
ttatccttcaatgtgccaaaccatccgattattccttttatcgaaggtgatggtattggc
gtagatatcacacctgtcatgattaaagtggtcgatgcggcggtagaaaaagcgtataaa
ggcaagaagtcaatcgtttggatggaaacctattgcggtgaaaaagccgccaaaatctac
gatggcgaatttatgccagaagagacgcttgaaatcttacgggattatgtcatcagtatc
aaaggcccactgaccacgccagttggcggtggtatgcgctccttaaacgtagccctgcgt
caagaacttgatttatacgtttgtcagcgtcctgtccgttggtttgaaggcgttccaagc
cccgttcatcatcctgaattgaccgacatgattattttccgtgaaaactcagaagatatc
tatgcgggtatcgagtggaaagcgggtagtgaagatgcgatcaaagtcattaagttttta
aaagaagagatgggcgttacgaagattcgttttccagaaaattgtggtatcggtatcaag
ccggtgtcaaaagaagggacgcagcgtctggtccgtaaagcaatccaacatgccatcgac
aatgatttacccagtgtgacgctcgtgcataaaggtaatattatgaagtacacggaaggc
gctttcaaagaatggggttatgagcttgctgccgagcgctttggtgcccaattgctagat
ggcggtccttggatgacgatgaaaaatccaaagacgggtcacgagattattatcaaagat
gtgattgctgatgcgttcttacagcaaatactgatgcgtcctgccgactactcagtaatt
gctacgctaaacctaaacggtgactacatctctgatgcgctagccgcagaagtcggtggt
atcggcatcgccccaggtgccaataagggtggcgctattgcggtctatgaagcgactcat
ggtacagcgccaaagtatgcaggacaaaataaagtgaatccaggttcattgatactttct
gctgagatgatgttaagagatatgggctggcttgaggcggctgacttggtaattaaaggt
atccaaggcgctattaaaaacaaaaccgttacttatgactttgagcgcttgatgccggat
gccatcctattaagtacttctgagtttgggaaagcgattatcaagcatatgaatgcttaa

DBGET integrated database retrieval system