KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1518Help
Entry
DABAL43B_1518     CDS       T04748                                 

Gene name
fadA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00071  Fatty acid degradation
psyc00072  Synthesis and degradation of ketone bodies
psyc00280  Valine, leucine and isoleucine degradation
psyc00310  Lysine degradation
psyc00362  Benzoate degradation
psyc00380  Tryptophan metabolism
psyc00620  Pyruvate metabolism
psyc00630  Glyoxylate and dicarboxylate metabolism
psyc00640  Propanoate metabolism
psyc00650  Butanoate metabolism
psyc00900  Terpenoid backbone biosynthesis
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01130  Biosynthesis of antibiotics
psyc01200  Carbon metabolism
psyc01212  Fatty acid metabolism
psyc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DABAL43B_1518 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    DABAL43B_1518 (fadA1)
   00640 Propanoate metabolism
    DABAL43B_1518 (fadA1)
   00650 Butanoate metabolism
    DABAL43B_1518 (fadA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DABAL43B_1518 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    DABAL43B_1518 (fadA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DABAL43B_1518 (fadA1)
   00310 Lysine degradation
    DABAL43B_1518 (fadA1)
   00380 Tryptophan metabolism
    DABAL43B_1518 (fadA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DABAL43B_1518 (fadA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DABAL43B_1518 (fadA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DABAL43B_1518 (fadA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psyc04147]
    DABAL43B_1518 (fadA1)
Enzymes [BR:psyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DABAL43B_1518 (fadA1)
Exosome [BR:psyc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DABAL43B_1518 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: SLJ84713
UniProt: A0A1U6GMF6
Position
I:complement(1736904..1738112)
Genome map
AA seq 402 aa AA seqDB search
MTETAYIYDSIRTPRGKGKKDGSLYQASPIWLVRGLLREMEQRHGLDTSLVDDVVLGCVT
PVGEQGADIARIAVLDAGWDQSVAGVTLSRYCASGLESINLAAAKVMSGMEEMVVAGGVE
SMSRVPMGSDGGAWYMDPRVNAATAFVPQGVGADTIATLKGFSRTDVDEFATESHRRAAN
AWEKGYFDKSVVPVKDLNGMLLLDKDETIRPSTTVETLAGLNPSFIMPGQMGFNSVILDK
YTTIEKVNHVHHAGNSSGIVDGAALCLVGSAAAGKKAGLKPRAKITMAAVIGSEPAIMLT
GPTPACQKALDKAGMKASDIDLWEINEAFAAVPLNTANDFGISLDIVNVNGGAIAMGHPL
GATGAMLMTTVLDELERRDLKTAMITLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaccgcttacatctatgacagtattcgtacgccgcgtggtaagggcaaaaaa
gatggctctctataccaagcttcacccatatggctagttcgtggtttattacgggagatg
gagcagcgtcatggtttagacactagcttagtcgatgatgttgtattaggctgcgttacg
ccagttggcgaacaaggggctgatattgctcgcattgcagtactcgatgcgggttgggat
caaagcgttgctggcgtaacgctttctagatattgtgcttcagggcttgagtccattaac
ctggctgccgctaaagttatgtctggtatggaagagatggtagtggctggtggcgtcgaa
tccatgagccgtgtcccaatgggatcagacggcggtgcttggtacatggatccgcgagtc
aacgcagcgactgcctttgtaccacaaggagtaggtgctgatactattgcaacgctcaaa
ggttttagtcgaactgatgtcgatgaattcgccactgaatcacatcgccgcgctgctaat
gcttgggaaaaaggctactttgataaatcagtagttcctgttaaagacctcaatggcatg
ctgctactagataaagatgagactatccgtccgagtactacggttgagactttagcagga
ttgaatccctcgtttattatgccaggtcagatgggtttcaatagcgttatcttggataaa
tacactaccattgaaaaagtaaaccacgtccatcatgctggaaactcttcaggtatcgtt
gacggtgcggcattatgtttagtcggtagcgctgctgctggcaaaaaagccggtctcaaa
ccgcgtgccaaaatcactatggctgcagtcataggttcagaaccggccattatgctaacg
ggtcctacgcctgcctgccaaaaagcattagataaagctgggatgaaagcctcagatatc
gatctttgggaaattaacgaagcttttgctgccgtaccactaaatactgctaatgacttt
ggcatttctctagatattgtcaacgtcaatggtggcgctattgccatgggtcatccgcta
ggtgcaacgggcgctatgcttatgactaccgtgcttgatgagctagagcgccgtgacctc
aaaacggcgatgattactctgtgcgtaggtggtggtatgggtattgcgactatcattgag
cgggtataa

DBGET integrated database retrieval system