KEGG   Psychrobacter sp. P11G5: AK825_01640Help
Entry
AK825_01640       CDS       T04411                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00071  Fatty acid degradation
psyg00072  Synthesis and degradation of ketone bodies
psyg00280  Valine, leucine and isoleucine degradation
psyg00310  Lysine degradation
psyg00362  Benzoate degradation
psyg00380  Tryptophan metabolism
psyg00620  Pyruvate metabolism
psyg00630  Glyoxylate and dicarboxylate metabolism
psyg00640  Propanoate metabolism
psyg00650  Butanoate metabolism
psyg00900  Terpenoid backbone biosynthesis
psyg01100  Metabolic pathways
psyg01110  Biosynthesis of secondary metabolites
psyg01120  Microbial metabolism in diverse environments
psyg01130  Biosynthesis of antibiotics
psyg01200  Carbon metabolism
psyg01212  Fatty acid metabolism
psyg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK825_01640
   00630 Glyoxylate and dicarboxylate metabolism
    AK825_01640
   00640 Propanoate metabolism
    AK825_01640
   00650 Butanoate metabolism
    AK825_01640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AK825_01640
   00072 Synthesis and degradation of ketone bodies
    AK825_01640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AK825_01640
   00310 Lysine degradation
    AK825_01640
   00380 Tryptophan metabolism
    AK825_01640
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AK825_01640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AK825_01640
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AK825_01640
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psyg04147]
    AK825_01640
Enzymes [BR:psyg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AK825_01640
Exosome [BR:psyg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AK825_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMN66583
UniProt: A0A127GWC1
Position
complement(378994..380175)
Genome map
AA seq 393 aa AA seqDB search
MSNDAIVIINGARTPMGSFQGALKDVSATDLGAAAIKAAVERSGVSTDSVDEVIMGCILT
AGLGQGPARQAMRKAGLPDATGAVTINKLCGSGLKAVMQAHDGIKAGSFNVAVAGGMESM
TNAPYIMPGSRGGYRMGHKEVKDHMFLDGLEDAETGRLMGQFAQEMADEKGYTREQMDEF
AIESLNRALTAIKDGHFKNEIEPVTFETRKGEQTVENDEEPGLANAERIPTLRPAFAKEG
TITAANASSISDGAAAVVMMKESQAKSEGLDYQARIIATASNSRHPSEFTIAPIGAIEKV
LANADWTVEDVDLWEINEAFAMVTMATMDALNIDHAKVNIEGGACALGHPVGCSGARILV
TLINSLQRTGGKKGIATLCIGGGEAVAVAIELA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgatgcaattgtaattatcaacggtgctcgtacgccaatgggtagctttcaa
ggcgctctaaaagacgttagtgctacagatttaggcgctgctgcaatcaaagcggctgtt
gagcgttcaggcgtgagcactgatagtgttgacgaagtcattatgggttgtatcttgacc
gctggtttaggtcaaggccctgctcgtcaagcgatgcgtaaagcaggcttgcctgatgcg
actggtgcagtcacaattaataagctttgtggttcaggtctaaaagccgttatgcaagcg
catgatggtattaaagctggcagcttcaatgtcgctgtcgctggtggtatggagtcgatg
accaatgcaccttatatcatgccaggatcacgtggcggataccgtatgggtcacaaagaa
gttaaagaccatatgtttttagacggcttagaagatgcagaaactggtcgcctaatgggt
cagtttgcacaagaaatggctgacgaaaaaggctatacgcgtgagcaaatggacgagttt
gctatcgaatcactaaaccgtgcattgactgctatcaaagacgggcatttcaaaaacgag
attgagccggtcacttttgagactcgtaaaggcgaacagacggttgagaatgacgaagaa
ccaggtcttgcaaacgctgagcgtattcctacgttacgtcctgcctttgctaaagaaggt
actatcactgccgctaatgccagctcaatctcagacggtgcagctgcagtcgttatgatg
aaagagtcacaagcgaagtctgaaggtttagattaccaagctcgtatcattgctactgct
tctaactcacgtcatccaagtgaatttacgattgccccgattggtgctatcgaaaaagta
ttggctaatgcagattggacagtagaagatgtcgatctttgggaaatcaacgaagctttt
gctatggtcacgatggcgactatggatgcgttaaatatcgatcatgctaaagtcaatatc
gaaggtggtgcttgtgcactaggtcaccctgtagggtgttcaggcgcgcgtattttagta
acgcttatcaactcgttacagcgtactggcggcaagaaaggcattgcaaccttatgtatc
ggtggcggtgaagcagtagctgtagctatcgaattggcttag

DBGET integrated database retrieval system