KEGG   Psychrobacter sp. P11G5: AK825_13875Help
Entry
AK825_13875       CDS       T04411                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00670  One carbon pool by folate
psyg01100  Metabolic pathways
psyg01120  Microbial metabolism in diverse environments
psyg01200  Carbon metabolism
Module
psyg_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:psyg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AK825_13875
Enzymes [BR:psyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AK825_13875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: AMN68635
UniProt: A0A127H2A6
Position
3379429..3381138
Genome map
AA seq 569 aa AA seqDB search
MTVPSDIAIAQNVTLQPINDIAQKLGLSATHIEPYGHFKAKINPADVFAMPAKAKQSKLI
LVTAINPTPAGEGKTTVTIGLADALNRIHKQQNSGERTVVAIREPSIGPVFGIKGGAAGG
GYAQVLPMEDINLHFTGDFHAIGAANNLLAALLDNHIYQGNELNIDPKQVFWRRAVDMND
RQLRNIISGIGKTTDGVMREDGFDITVASEVMAILCLATDLNDLKQRLGNILIAYNKDKQ
PIYAKNLNAHGAMAVLLKEAIKPNLVQTIEGTPAIVHGGPFANIAHGCNSVIATRVAMHL
ADYTLTEAGFGADLGAQKFCDIKCRLSGLTPDAAVIVATIRALKYNGCVAKENLTIENLA
ALEQGLPNLMKHIENMQEVYGLPVVVAINQFVSDTDAEIELVRQACLEKGVEVALTQVWE
KGGAGGEELANTLLSLLNDNSNKPSQFRLAYDSDNSIAEKIRTIAQRIYGADDIDISSLA
EAKISRLEELNLDKMPVCIAKTQYSLSDNAKLLGRPTGFNIHVRDISISSGAGFIVVICG
PIMKMPGLPKRPSAEHIDLDDAGNITGLF
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacctagcgatattgccatcgcccaaaatgttaccttacagcccatcaatgac
attgcacaaaaacttggtttatcagccactcacatcgaaccttacggacattttaaggca
aaaataaatccagccgatgtgtttgccatgccagctaaggcaaagcagagcaaattaata
ttggtcactgccattaacccaacgcctgctggcgaaggcaaaaccacggtcaccatcggc
ttggctgatgctctgaaccgcatccacaagcaacaaaacagcggtgagagaacggtggtt
gccatacgtgagccatccattggcccagtctttgggatcaaaggtggcgcagctggtggc
ggttacgcgcaagtactacctatggaagatatcaacctgcactttaccggtgactttcat
gcgatcggggcggcaaataacctgctggcagcgctattagacaaccatatctatcaaggt
aacgagctgaatatcgatccaaaacaagtattctggcgtcgtgcagtagatatgaatgat
cgtcaactgcgcaatattatcagcggtatcggcaagaccacagatggcgtgatgcgtgag
gatggttttgatattactgtcgcctctgaagtgatggctatcttgtgcttggcgacagac
ttaaacgatttaaaacagcgcctaggtaatatcttaatagcttataacaaagacaaacag
ccaatctacgccaaaaacctcaatgctcatggtgcaatggcggtactgttaaaagaagcc
attaaacccaatttagtccaaacgattgagggtacgcctgccatcgtccacggcggtcca
tttgccaatatcgcccacggctgtaactccgttattgcaacccgcgttgccatgcatttg
gcagactatacgcttactgaggcgggttttggtgccgaccttggtgcgcaaaagttctgt
gatatcaagtgtcgattgtcaggattgacgccagatgcggctgttatcgtcgccaccatt
cgagcgttaaaatacaatggttgtgtcgccaaagaaaatctaaccattgaaaacttagca
gcgcttgagcaaggcctgccaaatctaatgaagcatatcgaaaatatgcaagaagtctat
ggactgcccgtagtcgtcgccattaaccagtttgtcagtgataccgacgctgagattgag
ctggtgcgacaagcttgcctagaaaaaggcgtggaagttgccctaacgcaagtatgggag
aaaggtggcgctggcggtgaagaattagcaaatactttactaagtttgctcaatgacaac
agtaataaacctagtcaatttcgtttagcttatgacagtgacaacagtattgcagagaaa
attcgcacgattgcgcagcgaatctatggggctgatgatattgatattagcagtctggcc
gaggctaagataagccgcctagaagaactcaatctcgataagatgccagtttgtatcgcc
aaaacccagtattcgcttagtgataatgccaaactactggggcggcctacgggttttaat
attcatgtgcgcgatatcagcatctcctctggcgcaggttttatcgtggtgatttgtggc
cctatcatgaaaatgcctggattgcctaaacgcccttcagcggagcatattgatctagac
gatgctggtaatattactgggctgttttaa

DBGET integrated database retrieval system