KEGG   Psychroserpens sp. NJDZ02: E9099_03680Help
Entry
E9099_03680       CDS       T05945                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
psyn  Psychroserpens sp. NJDZ02
Pathway
psyn00361  Chlorocyclohexane and chlorobenzene degradation
psyn00625  Chloroalkane and chloroalkene degradation
psyn01100  Metabolic pathways
psyn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psyn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    E9099_03680
   00361 Chlorocyclohexane and chlorobenzene degradation
    E9099_03680
Enzymes [BR:psyn01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     E9099_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 PNK3P
Motif
Other DBs
NCBI-ProteinID: QCE40553
UniProt: A0A4P7WU17
Position
817948..818751
Genome map
AA seq 267 aa AA seqDB search
MKKETNKRRDFIKKAALASLVAPHLAFSSATENTTEAPKISIRPKVLFFDVNETLLDLTA
MKDSVGKVLGGRSDLLPLWFTTMLQYSLVNTVANQYHDFGIIGAAALQMVASNNGITLTE
EEAKNSILGPIRSLPAHPEVKASLQKLKDAGYKLVSFTNSSNKGVETQFKNSGLLDYFDE
RLSVEDIGKFKPHTDTYIWAARKMKIKPEECLLIAAHGWDIAGALWANWRGAFISRPGAQ
LYPLADKPEIIASDLALITDKLIALGH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagacaaacaaaagaagagatttcatcaaaaaagccgcattagctagttta
gtggcgccacatttagccttttctagcgcaacagaaaacacaacagaagcacccaaaatt
tcgatacgtccaaaagtattattctttgatgttaatgaaaccttattagatctgacagca
atgaaggatagtgttggaaaagtcctaggaggtcgatctgatttattaccattatggttt
acaacaatgttacaatactctctagtaaacaccgtagccaatcaataccatgactttggt
attatcggagctgcagccttacaaatggtagcttctaacaatggcattacacttacagaa
gaagaagcaaaaaactctattttgggtcccattagatcattacctgcacatccagaagtg
aaagcctctcttcaaaaattaaaagatgccggttacaaattagtatcatttaccaactcg
tctaataaaggtgtcgaaacacaatttaaaaactcaggcttattagattactttgatgag
cgcttaagtgtagaagatattggaaaatttaaaccacatactgacacttatatatgggct
gcaagaaaaatgaaaataaaacctgaagaatgcttgctaatagccgcacatggttgggac
atagctggtgcactttgggctaattggcgtggcgcgtttatcagtagacctggtgcacaa
ttatatcctttagctgataaaccagaaataatagcctctgatttagcactaattacagat
aaattaatagctttaggtcattaa

DBGET integrated database retrieval system