KEGG   Psychroserpens sp. NJDZ02: E9099_09645Help
Entry
E9099_09645       CDS       T05945                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
psyn  Psychroserpens sp. NJDZ02
Brite
KEGG Orthology (KO) [BR:psyn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    E9099_09645 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QCE41666
UniProt: A0A4P7WW22
Position
complement(2234046..2234432)
Genome map
AA seq 128 aa AA seqDB search
MVQQVTRGIKISVETNFEGTFYKNYKINFAFGYQVTIENQSKDSVQLNARYWTIYDALNN
EEIVAGEGVIGLKPVLQPGESHTYSSGCLLTSPFGAMKGYYSMVNFTTTKKFNVAIPSFK
LSAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaagttacaagaggtataaaaatttcggtggaaaccaattttgaagggaca
ttttataaaaactataagattaactttgcctttggatatcaagtaactatcgaaaaccaa
agcaaggattcggttcaacttaatgcaagatattggaccatctatgacgctttaaacaat
gaagaaatcgttgctggcgaaggcgttattggcctaaaaccagtattacaacctggcgaa
tctcacacttattcttcagggtgtctactaacctctccttttggcgcaatgaaaggctat
tacagcatggtcaactttaccactactaaaaagtttaatgttgctattcctagttttaaa
ttaagcgctccttttgctcttaattaa

DBGET integrated database retrieval system