KEGG   Psychroserpens sp. NJDZ02: E9099_16335Help
Entry
E9099_16335       CDS       T05945                                 

Definition
(GenBank) oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
psyn  Psychroserpens sp. NJDZ02
Pathway
psyn00633  Nitrotoluene degradation
psyn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psyn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    E9099_16335
Enzymes [BR:psyn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     E9099_16335
  1.-  
   1.-.-  
    1.-.-.-  
     E9099_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: QCE42913
Position
3682082..3682747
Genome map
AA seq 221 aa AA seqDB search
MNLQDTLNWRYTTKEYDTTKKISDADMAQVKNLLRMSPSSINLQPWHFIVAETTEGKARM
TKGTQGFFHFNEPKITNASAVVLFCSKTSEGADDTFFKHLLEVQDKDGRFPNEDIKNGMY
GGMNAFGDIHKYDLKDYQHWMEKQVYLNIGNFLLGVASLGIDATPMEGIDVKALDEEFGL
RAKGFTSLVVVSLGYRAASDFNSTDKTPKSRLPQSEIITVI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaagacacattaaactggagatatactacgaaggaatacgacacaaccaag
aaaatatctgatgcagatatggcacaagttaaaaacttattacgaatgagtccatcaagt
ataaacctgcaaccttggcattttatcgttgctgaaactacagaaggtaaagcacgtatg
acaaaaggaactcaaggcttttttcattttaatgaaccaaaaataacgaatgcatcagct
gtagtattgttttgttcaaaaacaagcgaaggtgcagatgatactttttttaaacacctt
ttagaagtacaggataaagacggaagattccctaatgaagacataaaaaacggaatgtac
ggtggaatgaacgcttttggagacattcataaatatgatttaaaagactatcaacattgg
atggaaaagcaggtatatcttaacattggtaactttttattaggagttgcaagtttaggt
atcgatgcaacaccaatggagggtattgatgtaaaagcgttagatgaagaatttggatta
agagcaaaaggatttacatctttagtcgttgtttctttaggatatagagcagcatctgat
tttaattcgactgataaaacaccaaaatctagattaccacaaagtgaaattatcactgta
atataa

DBGET integrated database retrieval system