KEGG   Psychrobacter sp. PAMC27889: E5677_06845Help
Entry
E5677_06845       CDS       T06076                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psyp  Psychrobacter sp. PAMC27889
Pathway
psyp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psyp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    E5677_06845 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psyp03400]
    E5677_06845 (recD)
Enzymes [BR:psyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     E5677_06845 (recD)
DNA repair and recombination proteins [BR:psyp03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     E5677_06845 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 SH3_13 AAA_11 Helicase_RecD UvrD-helicase DUF2075 AAA_22 Herpes_Helicase PhoH UvrD_C AAA_16 NACHT AAA_28 ResIII
Motif
Other DBs
NCBI-ProteinID: QCB30734
Position
complement(1636901..1639087)
Genome map
AA seq 728 aa AA seqDB search
MSNNNNKSKAAIGVKESWASNLSDYILLRRQQTHLAYSATDSKANTDSNQFDKTEDSMLF
TAFFVMLATHLEEGHTVLTIEEAEDEVPLQGQINHEFVALYGWQKALLAMLATPIFALID
TQISTQMEEDSTAEISLFTLLDTLFTKESQLWVQLALSNPEKEMLNKRFTTIASLYRLLK
NTDLDFFMELVTQHTLFADVGADITKQNSLSNNKPIIYKKIEHEKTSAVSITFWLHRSWQ
AEFNLAKHISTILEQPITPLALSIPKNLNEQQTKAINVANNNAFSIITGGPGTGKTYTVA
QLVIALQQATESRDEQQESIRFSTDSASLALAAPTGKAAQRMQESLQAALDTSEVKMQLQ
EAKTIHRLLGIGRTGRPRYDASNPLGEDIIIVDEASMLGVELANYLVSAVKPGARLILLG
DANQLAAVDAGAVLADLCHIPILQSIHAELLESRRFSAESGIGKLANQINQTEVDTQKIW
QLLKQDDALSFQYVNTLQIDESNDNKIKNSLSRNKNISRMTENYHPYIAKIKGLLENPMK
KSMPESVNATVTALIEVFNQFRILSAGHNGEWGDHYINNYLTQWHLAELKLPLGQNTWFH
GRPVMVLQNNYELGLFNGDIGFCLQTGDERSRLEVFFENKAQGIAVNLLNEEVIATAYAM
TIHKSQGSEFDHVAITFDNSHARLLSKELIYTAVTRAKKQVTIYSTKYAFEKAVQTPTER
HTGLGLQF
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataataacaataaaagtaaggcagcgattggggtaaaagaaagctgggccagt
aacctcagtgactacattctattacgccgtcagcaaacgcatttagcgtatagtgcaaca
gattcaaaagcaaatactgatagcaatcaattcgataaaacagaagacagtatgctattc
actgctttttttgtgatgttagcgacccatttagaagaggggcacacagtactaactatt
gaggaagctgaggatgaagtaccgttgcaaggccagatcaatcacgaattcgttgcgcta
tatgggtggcaaaaagcgttgttagcaatgctcgcaacgccaatcttcgctctgatagac
acccaaatcagtacacaaatggaagaggattcgacagctgaaatatcactatttaccttg
ctagatactttatttaccaaggaaagtcagctttgggtgcagcttgccctaagtaatcct
gaaaaagagatgctgaacaagcgctttactacgattgccagcttatatcgactactaaaa
aatacagatttagattttttcatggaattggtcactcagcatactttattcgcagacgtg
ggcgctgacatcacaaaacaaaatagcctaagcaacaacaaacccattatttataaaaaa
attgagcatgaaaaaacatcagcagtatccatcactttttggctgcatcgctcttggcaa
gcggagttcaacttagcaaaacacatcagtactattttagaacaacccataacacctcta
gcgttatccatacccaaaaacctgaacgagcaacaaacaaaagccatcaatgtggccaac
aacaatgcgtttagtatcatcactgggggtccaggcacaggcaaaacctatacggtcgcc
cagctcgttattgcgttacaacaggccacagagagtagggatgagcagcaagagagcatt
agattcagtacagatagtgcaagcctagcgctcgcagcaccgactggtaaagcagcacag
cgaatgcaagagtctttgcaagcggctctagatacatcagaagtgaaaatgcaattacaa
gaagccaaaaccatccatcgtttgctaggcatcggtagaacgggtagaccgcgttatgat
gccagtaatcctttgggtgaggacatcattattgttgatgaagcctcaatgctgggtgtt
gaattggccaattatcttgtcagcgccgtaaagccgggtgcaaggctgatactgttagga
gatgccaaccagctagcagcggtagatgcaggagcagtactggctgatttgtgtcatatt
ccgatattacaatccattcatgctgagctactcgaaagccgccgttttagcgcagaatca
ggtattggtaaacttgcaaatcaaatcaatcaaacagaagtagacactcaaaaaatttgg
cagttattaaaacaagacgacgcattgagcttccaatacgtaaacaccctgcaaatagat
gagagtaatgataataagataaaaaatagcctaagtagaaataaaaatatttcaagaatg
acagaaaattaccatccctatatagccaaaattaaaggtctactagaaaatccaatgaaa
aaatccatgccagaatcggtaaatgcgacagttacagcgctgatagaggtgtttaatcaa
tttagaattttaagcgcgggtcataatggtgaatggggtgatcactatatcaataattac
ctcacacaatggcatcttgctgaactcaaactaccactaggtcagaatacatggttccat
ggtcgccctgttatggttttacaaaataactatgagttaggattgtttaatggcgatatt
ggtttttgtttgcagacaggagatgagagaagtcgattagaagtgttttttgagaataaa
gcacaaggtatcgctgttaatctactgaatgaagaagtgattgcgaccgcatatgcgatg
accattcataagtcacagggatctgagtttgatcatgttgctattacttttgacaatagt
catgccagactgctcagcaaagagcttatttatacagcggtgacacgggctaaaaaacaa
gtgaccatctatagtacaaaatatgcgtttgaaaaagcagttcaaaccccaactgagcgt
catactggtttaggactacaattttag

DBGET integrated database retrieval system