KEGG   Pseudomonas syringae CC1557: N018_07045Help
Entry
N018_07045        CDS       T03014                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00860  Porphyrin and chlorophyll metabolism
psyr01100  Metabolic pathways
Module
psyr_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    N018_07045
Enzymes [BR:psyr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     N018_07045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHG40015
UniProt: W0MS01
Position
1482300..1482872
Genome map
AA seq 190 aa AA seqDB search
MTLRLDLLRHGETELGGGLRGSLDDALTDLGWQQMRAAVVDAGPWERIVSSPLQRCARFS
EELAQCLSLPLHLEPGLQELHFGDWEGHSPAQLMETDAEGLGLFWADPYTFTPPNGEPVT
DFSTRVLSAVERLHQAYGDERVLLVSHGGVMRLLLAQARGLPREQLLQVVVGHGALLSIQ
VAAGGLLIEA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcgactggatctgctgcgccacggtgaaaccgaactgggcggcggcctgcgc
ggcagtctcgatgatgccctgaccgatctcggctggcagcagatgcgtgcggcggtggtt
gatgccgggccttgggagcggattgtcagttcgcccttgcagcgctgcgcgcggttctcc
gaggagttggcgcagtgcttatcgttgcccttgcacctggagccgggtttgcaggagctg
cattttggcgattgggaaggtcacagccctgcgcaactgatggaaaccgatgccgaaggt
ctggggctgttctgggctgatccgtatacgttcacgccgcccaatggcgagccggtgact
gatttttcaacgcgggtgctaagtgccgtagagcgtttgcatcaggcttatggcgatgag
cgcgtgctactggtcagtcacggcggcgtcatgcgcttgctgctggcgcaggcgcgtggt
ttgccgcgtgagcaattgctgcaagtggtggtgggtcacggcgcgctgctgtctattcag
gtcgccgctggcggtctactcattgaggcctga

DBGET integrated database retrieval system