KEGG   Pseudomonas syringae CC1557: N018_11195Help
Entry
N018_11195        CDS       T03014                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00970  Aminoacyl-tRNA biosynthesis
psyr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N018_11195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psyr03029]
    N018_11195
Enzymes [BR:psyr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     N018_11195
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     N018_11195
Mitochondrial biogenesis [BR:psyr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    N018_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHG40783
UniProt: W0MUR1
Position
2410546..2411973
Genome map
AA seq 475 aa AA seqDB search
MIEPTQSVVPTLIEAIGHVRRGCMTPIRLTEICLESIKTHNSTLNAFGDVYTEAALEQAW
SMTAELQRGQVRGPLHGIPFGIKDLFSTAGLRTTRGSLTGLENVPAKDAPIIRRLKDAGA
IIVGKTATTEFGWTGASTSRVFGNGRNPWDPTLTSGGSSSGSAIAVAARMVPATLGSDGG
GSVRIPGAFCGAFALKGTLGRIPTWPWSATEMLSHAGPITRTVRDSALLFDILSGPDPLD
HQALPAPDESFLTRCDQPLQPLRIGYCPTLFDTPVDPEIAAAVEAAVGDIARTLPVTLTT
LKLDWQDPLATFETLWVAGRGIAYGKGLAQQMDQLDPGFAELIRRSAQYDLSDYLQAMQQ
RAAFANQVHALFEDYDLLLMPTLPILPFAADEVAPAGYVGQDGAVPWARWTPFTYPFNIS
GNPAASLPCGRSSTGLPIGLQVVGPRFADAQVLQFCAAVEDMAPWDQHLPPMLSR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgatagagcctacacaatccgttgtaccgacattgatcgaagcgatcgggcatgtgcgc
agaggctgcatgacccccattcgcctgactgaaatatgccttgaatcgatcaaaacccac
aattccacactcaatgcgtttggcgatgtctacaccgaagccgcactggagcaagcctgg
agcatgactgccgagttgcagcgcggtcaggtacgcggcccattgcatggcataccgttc
ggcatcaaggacctgttttcaacagcgggattgcgcaccacgcgtggttcgctgaccggg
cttgagaatgtaccggccaaggatgcgccgatcattcgccgtctcaaggacgccggggcg
atcattgtgggcaagacggcaactaccgagttcggctggaccggcgcaagtacttcgcgg
gtgttcggcaacggtcgcaacccatgggacccaaccctgaccagcggcggctccagctcc
ggctcggcgattgccgtagcggcgcgcatggtgcctgcgacactgggctccgacggcggc
ggctcggtgcggataccgggcgcgttctgcggcgcgttcgcgctcaagggcacattaggg
cgtattccaacctggccctggtcagccaccgaaatgctcagtcacgccgggccgatcacc
cgcaccgtacgcgacagtgccttgctgttcgacatactctcaggcccagatccactggat
catcaggcattgccggcgccagacgagtcctttctgacccgttgcgaccaaccgttacaa
ccgctgcgtattggctattgcccgaccctgttcgatacccccgtagacccggaaatcgcc
gctgccgtcgaggctgctgtgggcgatatcgccagaacactgccggtgacgctcacaaca
ctcaagcttgactggcaggacccgctggcgaccttcgaaaccctgtgggtggcaggtcgc
ggtatcgcttacggcaagggcctggcacagcaaatggaccagctcgacccgggtttcgcc
gagttgatcaggcgctcggcgcagtacgatctgagtgattacctgcaagcgatgcagcag
cgagcagcgtttgccaaccaggtacatgcgcttttcgaggattatgacctgctgctgatg
cccacattgccgatcctgccgttcgcggccgacgaggtggcacccgccggttacgttggc
caggacggcgccgtgccctgggcgcgctggacgccgtttacttaccctttcaacatctcc
ggcaacccggctgccagtttgccctgcggacgcagttcgaccgggctacccattggcctg
caagtggtcgggccacgttttgccgacgctcaagtgctgcagttctgcgccgccgtggaa
gacatggcgccgtgggatcagcacctgccgccgatgctgagccgctga

DBGET integrated database retrieval system