KEGG   Pseudomonas syringae CC1557: N018_13795Help
Entry
N018_13795        CDS       T03014                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00520  Amino sugar and nucleotide sugar metabolism
psyr01100  Metabolic pathways
psyr01503  Cationic antimicrobial peptide (CAMP) resistance
Module
psyr_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N018_13795
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    N018_13795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psyr01005]
    N018_13795
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     N018_13795
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     N018_13795
Lipopolysaccharide biosynthesis proteins [BR:psyr01005]
 Unusual sugar
  N018_13795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AHG41220
UniProt: W0MVH1
Position
complement(2934988..2936979)
Genome map
AA seq 663 aa AA seqDB search
MSTKAVVFAYHDIGCVGLQALLDADYEIAAVFTHADDPKEKTFFGSVAQLCAQHDIPVHA
PEDANHPLWVERIGKLAPDFIFSFYYRNLLSEPLLACANRGAFNLHGSLLPHYRGRAPAN
WVLVNGETETGVTLHQMVKRADAGPVFAQQRVSISVTDTALTLHGKLREAAIDLLSDTLP
LLAEGRLSGTPQDESQATCFGRRTTADGLIDWSLPATRLYDLIRAVTQPYPGAFCPVGDH
KLIIWTASVEPSNNGAAPGTVISHDPLRIACGQGSLIINAGQRGDEGLYLSGAQLAREFG
LVDGSQLLDTKKQRPVRRTRVLILGVNGFIGNHLSERLLQDDRYEIYGMDIGSDAIERLR
AKPNFHFIEGDISIHTEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIV
RYCVKYNKRVIFPSTSEVYGMCQDASFNEDTSNLVVGPINKQRWIYSVSKQLLDRVIWAY
GQKGLQFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCFT
DVADGIEALARIIENRDGRCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRNNFPPFA
GFRDVESQSFYGKGYQDVSHRKPSIDNARQLIGWTPNIELSETIGKTLDFFLREAMAEKA
DQC
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaagcggtcgtttttgcctatcacgatatcggctgtgtcggtctgcaagca
ttgctcgacgcggattatgaaatcgctgcagtatttacccatgcagacgatccgaaggaa
aaaaccttctttgggtcagtggctcaactgtgtgctcagcatgacattccggtgcatgcg
cccgaagacgccaaccacccgctgtgggtggaacgaatcggcaagctcgctccagatttc
atcttttccttctattaccgcaatcttctaagtgaacccctgttggcctgtgcaaacaga
ggcgcattcaatctgcatggttcgctgttaccgcactatcgcggtcgggcgcccgctaac
tgggtgttggtcaacggcgaaaccgaaaccggagtgaccctgcatcagatggtcaagcgc
gccgacgcaggtcccgttttcgctcagcagcgagtctcgatcagcgtcaccgacaccgcc
ctgacgcttcacggcaaactacgtgaagccgccattgacctgctgtcggacacattaccg
ctactcgctgaaggtaggctgtcgggcacgccccaggacgaatcccaggcaacctgtttc
ggtcggcgtaccacggccgacggccttatcgactggtcacttccggccactcgtctgtac
gatctgattcgcgcggtcacgcagccctaccccggcgcgttttgtccggtcggtgaccac
aagctgatcatctggacggccagtgtggagccctcgaataacggtgctgcgccaggcacg
gtcatcagccacgatccgttacgcatcgcgtgtggccagggttcgctgatcatcaatgcc
ggacaacgcggcgatgaaggcttgtacctcagcggcgcgcaactggcccgcgagttcggt
ctggtagacggctcacagttgctcgacacgaaaaagcagcggccggttcgacgtactcgc
gtgttgatcctcggcgtcaacggtttcatcggcaatcacttgtcggaacggctgttgcag
gatgaccgttacgaaatctacggcatggacattggttcagacgccatagaacgcttgcgt
gccaaaccaaactttcactttattgaaggcgacatcagcatccacaccgagtggattgag
taccacatcaaaaagtgcgatgtagtactgccgctggtggccatcgcaacacccattgaa
tacacccgcaatccactgcgcgtgttcgaactggacttcgaagaaaacctgaaaattgtt
cgctactgcgtcaagtacaacaagcgagtgatcttcccgtcgacgtccgaagtgtatggc
atgtgccaggacgccagttttaacgaagacacttcgaatctggtggttggcccgatcaac
aaacagcgctggatctattcggtttccaagcaattgctggatcgcgtgatatgggcctat
gggcagaaaggcctgcaattcacgctgttccggccgttcaactggatggggccgcgtctg
gaccgactggactcggcacgtatcggcagctcgcgggcaatcacccaattgatcctgcac
ctggtggaaggcacaccgattcggctggtggacggtggcgcccagaagcgctgcttcacc
gatgtagcagacggcatcgaggcgctggcgcggatcatcgaaaatcgcgacgggcgctgt
aacggtcagatcatcaacatcggcaacccggacaacgaagccagcattcggcagttgggt
gaggagctgctgcgccagttcgaggcccatccactgcgcaacaattttcctccgttcgcg
ggctttcgcgatgttgaaagtcagtcgttctacggcaagggttatcaggacgtcagccac
cgcaagccgagcatcgacaacgctcgtcagttgattggatggacgccgaacatcgagctg
agcgaaaccatcggcaagaccctggatttcttcctgcgtgaagccatggctgaaaaagcg
gaccagtgctga

DBGET integrated database retrieval system