KEGG   Pseudomonas syringae CC1557: N018_15375Help
Entry
N018_15375        CDS       T03014                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00020  Citrate cycle (TCA cycle)
psyr00620  Pyruvate metabolism
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01120  Microbial metabolism in diverse environments
psyr01130  Biosynthesis of antibiotics
psyr01200  Carbon metabolism
Module
psyr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N018_15375
   00620 Pyruvate metabolism
    N018_15375
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     N018_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AHG41498
UniProt: W0MWU1
Position
3417403..3419040
Genome map
AA seq 545 aa AA seqDB search
MFKKVNTALLGMAISMGIMPVHAAETKKVDVLLVGGGIMSATLAVWLNELEPSWSMEMVE
RLDGVAEESSNGWNNAGTGHSALAELNYTPEDKNGNVDISKAIEINEAFQISRQFWSWQV
KTGVLKDPRSFINSTPHMSFVWGDNNIQFLRKRYAALQASPLFSGMQYSEDHEQIKKWVP
LMMEGRDPAQKLAVTWSPIGTDVNFGEITRQFVANLKAKQNFNLQLSSEVEDINHNDDGT
WRVKYKNLKDGTVTETDTKFLFIGAGGAALHLLQESGIPEAKEYGGFPVGGSWLVTDNQT
LAMQHMGKAYGIASTGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKNGSYFDLLTS
TTTHNVWPMTRVGIEQYPLIEYLAGQVMMSDDDRFAALKEYFPNAKKEDWRLMQAGQRVQ
IIKRDEEKGGVLKLGTEIVASKDGSIAGLLGASPGASTAAPIMLGVLEKVFKDKVATPAW
QEKLHQIVPSYGTKLNNNPDRVAEEWAYTAEVLQLTPPPPVNKTGTAPTPAAQPAKSNPA
SDMAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaaagtgaatacggccctgctgggtatggccatctccatgggcatcatgccc
gtgcatgcagctgaaaccaaaaaagtcgacgtgctgcttgttggcggcggcatcatgagt
gcaaccctcgctgtctggctcaatgagctggagccgagctggtcgatggaaatggtcgag
cgtctcgacggcgtcgccgaagaaagctccaacggctggaacaacgccggtacaggtcac
tcggcgctggccgaactgaactacacccctgaagacaagaacggcaacgtcgacatctcc
aaggcgatcgagatcaacgaagcgttccagatctcccgtcagttctggtcctggcaggtc
aagaccggcgtcctgaaagacccgcgctcgttcatcaactccacgccgcacatgagcttc
gtgtggggcgacaacaacatccagttcctgcgcaagcgttacgcagcattgcaagccagc
ccgctgttcagcggcatgcagtactccgaggaccacgagcagatcaagaagtgggttccg
ctgatgatggaaggtcgtgacccggcgcagaagctggccgtgacctggagcccgatcggc
accgacgtcaacttcggcgagatcactcgtcagttcgtcgccaacctgaaagccaagcag
aatttcaacctgcagttgtcgagcgaagtcgaagacatcaatcacaacgacgacggcact
tggcgcgtcaagtacaagaacctgaaagacggtaccgttaccgaaaccgacaccaagttc
ctgttcatcggcgccggcggtgctgctctgcatctgctgcaagagtcgggcattcctgaa
gccaaggaatacggcggcttcccggttggcggttcgtggcttgtcactgacaaccagacc
ctggccatgcaacacatgggcaaggcctacggtattgcttcgaccggtgcgccacccatg
tcggttcctcacctggacacccgtgtcctggacggtaagcgcgtgatcctgtttggcccg
ttcgcgaccttctcgacgaagttcctgaaaaacggttcgtacttcgatctgctgaccagc
accaccactcacaacgtatggccgatgacccgcgttggtatcgaacagtacccgctgatc
gaatacctggcaggtcaggtgatgatgtctgacgacgatcgctttgctgccctgaaagaa
tacttcccgaacgccaagaaagaagactggcgcctgatgcaagccggtcagcgcgtacag
atcatcaagcgtgacgaagagaaaggcggcgttctgaaactgggtaccgaaatcgttgct
tccaaggacggctccatcgccggtctgctgggcgcatcgccaggtgcttcgaccgcagcg
ccaatcatgctgggtgtgcttgagaaagtcttcaaggacaaggtagcgactccggcctgg
caggaaaaactgcaccagatcgtacctagctacggcaccaagctgaacaacaacccggat
cgcgttgccgaggaatgggcttacacagccgaagttctgcaactgactccaccaccgccg
gtgaacaagacaggcacggccccaacgcctgccgcccagccagcgaaaagcaatccagcc
agtgacatggctctttaa

DBGET integrated database retrieval system