KEGG   Pseudomonas syringae CC1557: N018_16015Help
Entry
N018_16015        CDS       T03014                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00020  Citrate cycle (TCA cycle)
psyr00480  Glutathione metabolism
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01120  Microbial metabolism in diverse environments
psyr01200  Carbon metabolism
psyr01210  2-Oxocarboxylic acid metabolism
psyr01230  Biosynthesis of amino acids
Module
psyr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N018_16015
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N018_16015
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     N018_16015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AHG41622
UniProt: W0MT61
Position
3556851..3559073
Genome map
AA seq 740 aa AA seqDB search
MSNRSKIIYTFTDEAPALATYSLLPVIEAFTATSDIDVETRDISLAGRVLSSFPELLADK
KVPDHLAELGKLATTPEANIIKLPNISASVPQLKATIKELQNQGYNIPDYPENPATDAEK
ETRARYDKTKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWSADSKAHVAHMSNGD
FYGSEKATQIEADNTVKIELVAQDGTTTVLKEKTAVKAGEVVDCSVMSAKALRSFIAAEI
EDARKQGVLFSVHLKATMMKISDPIMFGQIVDEFYKDALTKHADTLKQIGFSLNNGIGDL
YERIGVLPAEKQAEIKADIEAVYAVRPQLAMVNSDKGITNLHVPSDVIVDASMPAMIRDS
GKMWGTDGQLHDAKAVIPDRCYATIYQAVIEDCKKNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFHIQANGVVRVTDSQGNLLMEQNVEAGDIWRMCQAKDAPIQDWVKLAVNRARAS
NTPAIFWLDASRAHDSVMIEKVQKYLGDHDTTGLDIQILSPVDAMKLTLQRTRAGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQFVEENFLR
WDSLGEFLALAASLEHLGNVYNNPKALVLSKTLDQATGEFLDRNKSPSRKVGGIDNRGSH
FYLTLFWAQALAAQNDDAALKAQFTPLAKTLTDNEEKIVAELNAVQGKPVDIGGYYFPNP
EVTSKAMRPSATFNAAIAAL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccgctcgaagatcatctacaccttcaccgacgaagctccggccctcgccacc
tactcccttctgcctgtcattgaagcgttcacggcaacctccgatattgacgtggaaaca
cgcgacatctctctggcgggccgtgttctttccagcttcccggagttgcttgccgacaaa
aaagtgccggatcatctcgccgagctgggcaaactggccaccacgccagaagccaacatc
atcaagctgcccaacatcagcgcctcggtcccgcagttgaaggcgaccatcaaggagctt
cagaatcagggctacaacatccctgactaccctgagaaccctgccactgatgcggaaaaa
gaaacccgtgcccgctacgacaagaccaagggcagcgccgtaaacccggtgctgcgtgaa
ggtaactctgaccgccgtgcgccgttgtcggtcaagaactacgcccgcaagcacccgcac
aaaatgggcgcctggtccgccgattcgaaagcgcacgttgcacacatgagcaacggtgac
ttctacggcagcgagaaagccacccagatcgaagccgacaacaccgtcaagatcgaactg
gtcgcccaggatggcaccaccaccgtcctgaaagaaaaaaccgccgtcaaggcaggcgaa
gtcgtcgattgctcggtgatgagcgccaaggcactgcgtagcttcatcgctgctgaaatc
gaagacgcccgcaaacaaggcgtgctgttttcggtgcacttgaaagccaccatgatgaag
atctccgatccgatcatgttcggccagattgtcgacgagttctacaaggacgcgctgacc
aagcacgctgatacgttgaaacagatcggcttcagcctgaacaacggcattggtgacctg
tacgagcgcattggtgttctgccagcggaaaagcaggcggaaatcaaggccgacatcgag
gcggtctacgccgtccgtccgcaactggcgatggtcaactccgacaagggcatcaccaac
ctgcacgtaccgagcgacgtgatcgtcgacgcatcgatgccagccatgatccgtgactcc
ggcaaaatgtggggcacagacggtcagttgcacgatgccaaggccgtcattccggaccgt
tgctacgccactatttatcaagccgtcatcgaagactgcaagaaaaacggtgccttcgat
ccgactaccatgggcagcgtgccaaacgtcggcctgatggctcagaaagccgaagagtac
gggtcccacgacaagaccttccatatccaggccaacggtgtggttcgcgtgaccgacagc
caaggcaacctgctgatggagcagaacgtcgaagctggcgatatctggcgcatgtgccag
gccaaggacgcgccgattcaggactgggtgaaactggccgtcaaccgcgctcgcgcaagc
aacacgccagcgattttctggctggatgcgtctcgcgcccatgacagcgtgatgatcgag
aaagtccagaagtacctgggcgaccacgatacgacggggctggacatccagatcctgtcg
ccggtcgacgccatgaagctgaccctgcagcgcactcgcgccggcaaggacaccatctcg
gtgaccggtaacgtgctgcgcgactacctcaccgacctgttcccgatcatggaactgggt
accagcgcgaaaatgctgtcgatcgttccgctgatgaatggtggcggcctgttcgaaacc
ggcgctggcggttcggctccgaagcatgttcagcagttcgtcgaagagaacttcctgcgc
tgggattcgctgggcgagttcctcgccctggcagcctcgctggagcatctgggtaacgtt
tataacaacccgaaagcgctggttctttccaaaaccctggaccaagccactggcgagttc
ctggatcgcaacaagtcaccttcgcgcaaggttggcggtattgacaaccgtggcagtcac
ttctacctgaccctgttctgggcacaggcactggccgcccagaatgacgatgcagccctc
aaggcgcagttcacacctctggccaaaaccctgaccgacaacgaggaaaaaatcgttgcc
gagctgaacgctgttcagggcaagccagtggacatcggcggctactacttccctaacccg
gaagtaaccagcaaagccatgcgcccaagtgcaacattcaacgcagccatcgcagcgttg
taa

DBGET integrated database retrieval system