KEGG   Pseudomonas syringae CC1557: N018_17415Help
Entry
N018_17415        CDS       T03014                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
psyr  Pseudomonas syringae CC1557
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    N018_17415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHG41891
UniProt: W0MYK1
Position
3871124..3872740
Genome map
AA seq 538 aa AA seqDB search
MATNALSPDAGARASLSASQFGRKPSRMTMILFFVILIAGLLFTGYSLKQDVDDMGTVVT
TWTPFVLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPGFAVVWSGFFNFLGVMMS
SGAVAFGIIALLPVELILQTGSSAGFAMIFALLIAAIIWNLGTWWLGLPASSSHTLIGSI
IGVGIANALMHGRDGTSGVDWSQATKIGYSLLLSPLVGFGCAALLLLAMRMFIKNRALYK
APEGNAPPPLWIRAMLIVTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPAE
QSTQFAAVAEVTQQALTRSVPQPAPDDSRKTLSAYLVSKQASPELIPALAVMAGKIGDQV
ASYGSLSKVPAEAVTNVRNDMYLTSETIRVMEKNKVGNFDVDTQNKLDAFKEQIDNATRF
IPTWVKIVVAIALGLGTMVGWKRIVVTVGERIGKTHMTYAQGASAEVVAMFTIGAADMYG
LPVSTTHVLSSGVAGSMVANGSGLQMRTLRNLATAWVLTLPAAILLSGSLYWVFSKLF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaatgcactttctcccgatgccggcgcccgggcgagcctgtcggccagtcaa
ttcggtcgcaaacccagccgaatgaccatgatacttttcttcgtgatcctcatcgcgggc
ctgttgttcaccggctacagcctcaagcaggacgtggacgacatgggcacggtggtcacc
acctggacacctttcgtactgctgggtgtggcgctgctgatcgcactgggcttcgaattc
gtcaacggctttcatgacaccgccaacgcggtcgcaacggtgatctacacccactccctg
ccgcccggttttgccgtggtctggtcggggtttttcaattttctgggcgtcatgatgtcc
agcggcgcggtggcgttcggcatcatcgccctgctgccggtggaactgattctgcagacc
ggttcatcggcaggcttcgcgatgatcttcgcgctgctgatcgcggccatcatctggaac
ctgggcacctggtggctgggcttgccagcgtcctcgtcgcacacactgatcggctcgatc
atcggtgtcggtatcgccaacgcgttgatgcacggacgtgatggcaccagcggtgtggac
tggtcgcaggccaccaagatcggctactcgctgctgctttcgccattggtcgggttcggc
tgtgccgcgctgctgttgctggccatgcgcatgttcatcaagaatcgcgcgctgtacaag
gcacccgaaggcaacgcaccgccgccgttgtggattcgcgccatgctgatcgtgacctgc
accggcgtgtcatttgcacacggctccaacgacggacagaaaggcatgggcctgatcatg
ctgatcctggtcggcaccctgccgatggcttacgcgctgaaccgcaccatgcctgccgaa
cagtcgactcagttcgctgccgtggcagaagtcacccagcaggcgctgacgcgcagtgtc
ccgcaacccgcaccggacgattcgcgcaagacgctttccgcttatctggtcagcaaacag
gccagccccgagctgatcccggcgctggcggtcatggccggcaagatcggcgaccaggtc
gccagctacggctcgctgtcgaaggtgcctgccgaggccgtgaccaacgtacgtaacgac
atgtacctgacgtcggaaaccatccgtgtgatggaaaaaaacaaggtcggcaatttcgac
gtcgatacccagaacaagctcgatgctttcaaagagcagatcgacaatgccacgcgcttc
attccgacctgggtcaaaatcgtggtggccatcgccctcgggctgggcaccatggtgggc
tggaagcgcattgtcgtgaccgtcggtgagcggatcggcaagacccacatgacctacgca
caaggcgcgtcggcagaagtcgtggcgatgttcaccatcggcgcggccgacatgtacggg
ctgccggtatccactacgcatgtgctgtcgtccggcgtggccggttctatggtcgccaac
ggctccggcctgcaaatgcgcaccctgcgcaacctggccactgcctgggtactaaccctg
ccggcggcgatcctcttgtcaggttcgttgtattgggtgttcagcaagctgttctga

DBGET integrated database retrieval system