KEGG   Pseudomonas syringae CC1557: N018_20050Help
Entry
N018_20050        CDS       T03014                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00030  Pentose phosphate pathway
psyr00480  Glutathione metabolism
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01120  Microbial metabolism in diverse environments
psyr01130  Biosynthesis of antibiotics
psyr01200  Carbon metabolism
Module
psyr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psyr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
psyr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    N018_20050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    N018_20050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psyr04147]
    N018_20050
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     N018_20050
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     N018_20050
Exosome [BR:psyr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   N018_20050
  Exosomal proteins of colorectal cancer cells
   N018_20050
  Exosomal proteins of bladder cancer cells
   N018_20050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHG42389
UniProt: W0MV13
Position
complement(4437139..4438608)
Genome map
AA seq 489 aa AA seqDB search
MPLITVEPCTFALFGALGDLAVRKLFPALYQLDRAGLLHEDTRILALAREPGDEQSHLAY
IEKSMRRFIPEAELEAENAQRFLARLSYLHVDFLKAEDYVALAERVGDAETLIAYFATPA
SVYGAICENLASVNLAERTRAVLEKPIGHDLASSRRVNDAVAQFFPENRVYRIDHYLGKD
TVQNLIALRFANSLFETQWNQNHISHVEITVAEKVGIEGRWGYFDQAGQLRDMIQNHLLQ
LLCLIAMDPPSDLSADSIRDEKVKVLKALAPFTPERLATQVVRGQYTSGYSEGKAVPGYL
EEENSNTQSDTETFVALRADIRNWRWSGTPFYLRTGKRMPQKLSQIVIHFKEPPHYIFAP
EQRLQISNRLIIRLQPDEGISLQVMTKDQGLDKGMQLRSGPLQLNFSDTYRSARVPDAYE
RLLLEVMRGNQNLFVRKDEIEYAWQWCDQLIAGWKKAGDAPKPYPAGTWGPMSSIALITR
DGRSWYGDM
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgattacggttgaaccgtgcacatttgccctgtttggtgccctgggggacctg
gcggtacgcaagctgttcccggctctttatcagcttgatcgcgctggactgctgcatgaa
gacactcgaattcttgccctggcgcgtgaaccaggcgacgagcagtcgcatctggcgtac
atcgaaaaatccatgcgtcgcttcattcccgaagcggaactcgaagcagagaatgcccaa
cgctttctggcgcggctcagctatctgcacgtcgacttcctcaaggccgaggattatgtg
gcgctggccgagcgcgttggcgatgccgaaaccctgattgcctacttcgcgaccccggcc
tcggtctacggtgcgatctgcgagaacctcgcgtcggtgaacctggccgagcgcacacgc
gcggtgctggaaaagcccatcggccacgacctggcttcttcgcggcgggtcaacgacgcc
gtggcgcagttcttcccggaaaaccgcgtctatcgcatcgaccattatctgggcaaggac
acggtacagaacctcatcgcgctgcgttttgccaacagcctgttcgagacccagtggaat
cagaaccatatttcccacgtggaaatcacggtggctgaaaaagtcggcatcgaggggcgc
tggggctacttcgatcaggccggccagctgcgcgacatgattcagaatcacttgctgcag
ctgctttgcctgatcgccatggacccgcccagcgacctgtctgccgacagtattcgtgac
gagaaggtcaaggtgctcaaagcgctggcgccgttcacgccggagcgtctggctacacaa
gtggtgcgtggtcagtacacctccggttacagcgaaggcaaggccgtgccgggttatctg
gaggaggagaactccaacacccagagcgatactgaaaccttcgtcgcgctgcgtgccgac
atccgcaactggcgctggtcgggcacaccgttctatctgcgtaccggcaagcgcatgccg
cagaagctgtcgcagatcgtgatccacttcaaagagccgccgcactacatctttgctcct
gagcagcgtttgcagatcagcaaccgcctgatcattcgcttgcagcctgacgaaggcatt
tccttgcaggtgatgaccaaggaccagggcctggacaaaggcatgcagctgcgcagcggc
cccttgcaactgaatttttccgacacctaccgcagcgctcgggtccccgacgcttatgag
cggttgttgctggaagtcatgcgtggcaatcagaacctgtttgtccgcaaagatgaaatc
gagtacgcctggcaatggtgcgatcagttgatcgctggctggaagaaggcgggcgatgcg
cctaagccttatccggcgggtacctgggggcctatgagctccattgctttgattactcgc
gacgggagatcctggtatggcgatatgtga

DBGET integrated database retrieval system