KEGG   Pseudomonas syringae CC1557: N018_21570Help
Entry
N018_21570        CDS       T03014                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00280  Valine, leucine and isoleucine degradation
psyr00310  Lysine degradation
psyr00362  Benzoate degradation
psyr00380  Tryptophan metabolism
psyr00620  Pyruvate metabolism
psyr00630  Glyoxylate and dicarboxylate metabolism
psyr00640  Propanoate metabolism
psyr00650  Butanoate metabolism
psyr00900  Terpenoid backbone biosynthesis
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01120  Microbial metabolism in diverse environments
psyr01130  Biosynthesis of antibiotics
psyr01200  Carbon metabolism
psyr01212  Fatty acid metabolism
psyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N018_21570
   00630 Glyoxylate and dicarboxylate metabolism
    N018_21570
   00640 Propanoate metabolism
    N018_21570
   00650 Butanoate metabolism
    N018_21570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N018_21570
   00072 Synthesis and degradation of ketone bodies
    N018_21570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N018_21570
   00310 Lysine degradation
    N018_21570
   00380 Tryptophan metabolism
    N018_21570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N018_21570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N018_21570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N018_21570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psyr04147]
    N018_21570
Enzymes [BR:psyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N018_21570
Exosome [BR:psyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N018_21570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG42671
UniProt: W0N0Q4
Position
4771063..4772241
Genome map
AA seq 392 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAAIPAVDLGAAVIRQLLAQTGVDGAHVDEVIMGQVLTAG
AGQNPARQAAIKAGLPFSVPAMTLNKVCGSGLKALHLAAQAIRCGDADIIIAGGQENMSL
SNYVMPGARTGLRMGHATMVDTMISDGLWDAFNDYHMGITAENLAQQYDISREAQDAFAA
HSQQKAIAAIEAGRFADEITPILIPQRKGDPVSFAVDEQPRAGTTAETLGKLKPAFKKDG
TVTAGNASSLNDGAAAVMLMSAAKAEQLGLPVLARVAAYANAGVDPAIMGIGPVSATRRC
LDKAGWALDELDLIEANEAFAAQSLSVGKELGLDPEKLNVNGGAIAIGHPIGASGCRVLV
TLLHEMIRRDAKKGLATLCIGGGQGVALALAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgttatcgttgccgccacccgcaccgccgtgggcagtttccagggctca
ctggcggccattccagcggtcgatctgggtgctgcggtcattcgccagctgcttgcgcag
accggtgtggatggcgcgcacgtcgatgaagtcatcatgggccaggtactcaccgctggc
gccgggcagaaccctgcgcgacaagccgccatcaaggcaggcctgcccttctcggtcccg
gccatgaccctcaacaaggtgtgcggctcgggactcaaagccctgcatctggccgctcag
gcgattcgctgtggcgacgctgacatcatcatcgccggcggccaggagaacatgagcctg
tccaactacgtcatgcccggcgcgcgaaccggcctgcgcatgggccacgcaaccatggtc
gacacgatgatcagtgacggtctgtgggacgcattcaacgattaccacatgggcatcacc
gcagaaaacctggcgcagcaatacgacatcagtcgcgaggcacaggatgccttcgccgcg
cattctcagcagaaagcgattgccgccatcgaagccgggcgctttgccgacgagatcacc
ccgatcctgattcctcagcgcaagggcgacccggtgtccttcgcggtcgatgagcaacct
cgtgccggtaccacggccgaaaccctgggcaaactcaaacctgcattcaaaaaggacggc
acggtcacggccggtaacgcctcgtcactcaacgacggcgctgccgcagtgatgctgatg
agcgctgccaaagcagaacaactgggactgccagtgctggcacgcgttgctgcttatgcc
aacgccggcgtggacccggcgatcatgggcatcggcccggtcagcgccactcgccgctgc
ctggacaaggctggttgggcactggacgaactggacctcatcgaagccaacgaagcattt
gccgcgcaatctctgtcggtgggcaaggaactggggctggacccggagaagctcaacgtc
aacggcggagccattgctatcggccacccgattggcgcatcaggctgccgcgtgctggta
acgctgctgcacgagatgatcaggcgggatgcgaaaaaaggtctggccacgctgtgcatc
ggtggtggccagggggttgccctcgcgctggcgcgctga

DBGET integrated database retrieval system