KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0531Help
Entry
PSTAB_0531        CDS       T01571                                 

Gene name
mmsA
Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00280  Valine, leucine and isoleucine degradation
psz00410  beta-Alanine metabolism
psz00562  Inositol phosphate metabolism
psz00640  Propanoate metabolism
psz01100  Metabolic pathways
psz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PSTAB_0531 (mmsA)
   00562 Inositol phosphate metabolism
    PSTAB_0531 (mmsA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAB_0531 (mmsA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTAB_0531 (mmsA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     PSTAB_0531 (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     PSTAB_0531 (mmsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Halo_GVPC
Motif
Other DBs
NCBI-ProteinID: AEJ03812
UniProt: F8H8H6
Position
578969..580471
Genome map
AA seq 500 aa AA seqDB search
MQTLGNLINNEAVAGRSERHATVYNPATGEPRLYVSLSSADETRQAIAAAQAAFDGWSKT
PPLVRARVMFRFKELLERRRDDVARLITSEHGKVFSDAQGEVTRGLEVVEFACGIPHLLK
GEFSSNVGRDIDSNSLMQPLGVCAGITPFNFPAMVPLWMLPVAIACGNTFVLKPSEKDPS
ATMLIGELLAEAGLPAGVLNIVNGDKEAVDVLLTDERVQSVSFVGSTPIAEYIYATASAH
GKRCQALGGAKNHMVVMPDADPQQVVSSLMGAAYGSAGERCMAISVAVCVGDEVADKLVE
MLKGEISQMRTGPGLGVEPEPHMGPLVTREHQQKVSGYIDLGVAEGATLVCDGRGIKVEG
HENGFYVGPTLFDRVTPDMRIYREEIFGPVLAVVRVASFDEALQLINDHEFGNGTSIFTR
DGDTARQFEENVKVGMVGVNVPIPVPMAFHCFGGWKRSVFGPLNMHGPDGVRFFTRMKTV
TRRWPTGIRAGTEFAMPTMK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctcggcaacctgatcaacaacgaggccgtcgccggccgctccgagcgccat
gccaccgtctacaacccggccaccggcgagccgcgcctgtatgtctcactgtcctcggcg
gacgagacccgccaggccattgccgctgcccaggccgccttcgatggctggtcgaagacg
ccgccgctggtgcgcgcgcgggtcatgttccgcttcaaggaactgctcgagcgccgccgc
gacgacgtcgcccgcttgatcaccagtgagcatggcaaggtattttccgacgcccagggc
gaggtgacccgcgggctggaagtggtggagttcgcctgcggcatcccgcatctgctcaag
ggcgagttttcttccaacgtcggccgcgacatcgattcgaattcgctgatgcagccgctc
ggtgtctgcgccgggatcaccccgttcaacttcccggccatggtgccgctgtggatgctg
ccggtggccatcgcctgcggtaacaccttcgtcttgaagccctcggaaaaggaccccagc
gcgacgatgctgatcggcgaacttctggccgaggcggggctgccggctggtgtgctgaac
atcgtcaacggcgacaaggaggcggtggacgtgctgctcaccgatgagcgggtgcaatcg
gtcagcttcgtcggctcgacgcccatcgccgaatacatctatgccaccgcctcggcccac
ggcaagcgctgccaggcgctgggcggggcgaagaaccacatggtggtgatgcccgacgcc
gatccgcagcaggtggtcagctcgctgatgggcgcggcctacggctccgccggcgagcgc
tgcatggcgatttccgtcgcggtgtgtgtcggcgacgaggtggctgacaagctggtcgaa
atgctcaaaggcgaaatcagtcagatgcgcaccggcccgggcctgggcgtcgagcccgag
ccgcacatgggcccgctggtgacccgcgagcaccagcagaaggtcagcggctacatcgat
ctgggcgtggcggaaggtgcaacgctggtctgcgacggccgcggcatcaaggtcgagggc
cacgagaacggcttctatgtcggcccgacgctgtttgaccgggtcacgccagacatgcgc
atctaccgcgaggagatcttcggcccggtgctggccgtggtgcgggttgcgtcgttcgac
gaggcgctgcaactgatcaacgaccacgagttcggcaacggcacctcgatcttcacccgt
gacggcgacaccgcgcggcagttcgaggagaacgtcaaggttggcatggttggcgtcaac
gtgccgattccggtgccgatggccttccattgcttcggcggctggaagcgctcggtgttc
ggcccgctgaacatgcacggcccggatggggtgcgtttcttcacccggatgaagaccgtg
acccggcgctggcccaccggtatccgtgccggcaccgagttcgccatgccgaccatgaag
tag

DBGET integrated database retrieval system