KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0636Help
Entry
PSTAB_0636        CDS       T01571                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00250  Alanine, aspartate and glutamate metabolism
psz00310  Lysine degradation
psz00650  Butanoate metabolism
psz01100  Metabolic pathways
psz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSTAB_0636 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSTAB_0636 (gabT)
   00310 Lysine degradation
    PSTAB_0636 (gabT)
Enzymes [BR:psz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSTAB_0636 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PSTAB_0636 (gabT)
Amino acid related enzymes [BR:psz01007]
 Aminotransferase (transaminase)
  Class III
   PSTAB_0636 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEJ03917
UniProt: F8H991
Position
700593..701873
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFADHAKNSSVVDVEGREFIDFAGGIAVLNTGHLH
PKIVKAVEDQLHKLTHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAFHGRTMMTLGLTGKVAPYSAGMGLMPGGIFRAQYPCAIHGVS
VDDSIASIERIFKNDAEPRDIAAIIVEPVQGEGGFNVAPKDFMARLRALCDEHGILLIAD
EVQTGAGRTGTFFAMEQMGVVADLTTFAKSVGGGFPIAGVCGKAEIMDAIAPGGLGGTYA
GNPLSCAAALAVMEIFEEEHLLDRCKAVAEKLTAGLKAIQAKHKEIGEVRGLGAMIAIEL
FEDGDLARPAAALTSQIVARAREKGLILLSCGTYYNVLRVLVPLTVEDELLERGLAILGE
CFDELT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgatgcaacgccgtgtcgccgctgttccccgtggcgtc
ggccagatccacccgatctttgccgaccacgcgaagaacagcagcgtggtggatgtggag
ggccgcgagttcatcgatttcgccggcggcatcgccgtgctgaataccggccacctgcac
ccgaagatcgtcaaggcggtggaagaccagctgcacaagctcacccacacctgcttccag
gtgttggcctacgagccgtacgtcgagctgtgcgagaagatcaacgcgcgggtaccgggt
gatttcgccaagaagactctgctggtcaccaccggctccgaggccgtggagaacgcggtg
aagatcgcccgcgccgccaccggccgtgccggcgtgattgccttcaccggcgcctttcac
ggccgcaccatgatgaccctcggtctgaccggcaaggtcgccccgtactccgccggcatg
ggcctgatgcccggcgggatcttccgtgcgcagtatccctgcgcgatccatggtgtcagc
gtcgatgactcgatcgcgagcatcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcgatcatcgtcgaaccggtgcagggcgagggcggcttcaatgtcgcgccgaag
gatttcatggcccgcctgcgcgcgctctgcgacgagcacggcatcctgctgatcgccgac
gaggtgcagaccggcgccggacgcaccggcaccttcttcgccatggagcagatgggcgtg
gttgccgacctgaccaccttcgccaaatccgtcggtggtggtttcccgattgctggtgtc
tgtggcaaggccgagatcatggatgccatcgcgcccggcgggctgggcggcacctatgcc
ggcaacccgctgtcctgcgcggcggcgctggcggtcatggaaatcttcgaggaggagcat
ttgctcgaccgctgcaaggcggtggcggagaagctcaccgccggcctcaaggcgatccag
gccaagcacaaggagatcggcgaggtgcgcggcctcggcgcgatgatcgccatcgagctg
ttcgaggatggcgacctggcgcgaccggccgcggcgctgacgtcgcagatcgtcgcccgg
gcgcgggagaagggcttgatcctgctgtcctgcggtacctactacaacgtgctgcgcgtg
ctggtgccgctgaccgtcgaggacgagctgctcgagcgcggcctggccatcctcggcgag
tgtttcgacgagctgacctga

DBGET integrated database retrieval system