KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0675Help
Entry
PSTAB_0675        CDS       T01571                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PSTAB_0675 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psz03011]
    PSTAB_0675 (rplV)
Ribosome [BR:psz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PSTAB_0675 (rplV)
  Bacteria
    PSTAB_0675 (rplV)
  Archaea
    PSTAB_0675 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEJ03956
UniProt: A0A4P1S9F0
Position
748559..748891
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGDALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgcatctccgcccagaaagcccgcctggtc
gccgaccagatccgcgggaagaaggtgggcgatgcgctcaacctcctggctttcagcagt
aagaaagccgccgagatcatgaagaaggtgctggagtcggccgttgccaacgccgagcac
aacgaaggcgctgatgtggatgacctgaaagtctccaccgtcttcgtcaacgaagggcgt
tcgcttaagcgcatcatgccgcgtgccaaaggccgcgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgcggacaagtaa

DBGET integrated database retrieval system