KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1202Help
Entry
PSTAB_1202        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEJ04483
UniProt: F8H1Z2
Position
1258292..1260448
Genome map
AA seq 718 aa AA seqDB search
MAQPHAVEVLLRPAVELYTVAVCTGAAILCLVAPWSLALNPLLGLGSALAFLTFGAIRLR
DAWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGQGFRWEQRHTHRLMQTYRPEFRRYV
EPTAIYRAARRLEERLEFAPFPVSTLARALAWDSPLNPARPLPSVGGLPRLHGIEPAEVD
VTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRKVRGEHEVVIVFDPKGDADLLKRM
YVEAKRAGREGEFYVFHLGWPDISARYNAVGRFGRISEVATRIAGQLSGEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDALFIEYAQHYFAKNEPKAWEVIVQLEAKL
NEKNIPRNMIGREKRVVALEQYLSQVRIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAQLLAPNYSDLSDPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGVDDGLPGAAAGAKIPINVHADEFNELMGDEFIPMVNKGGGAGVQVTAYT
QTLSDIEARIGNRAKAGQVVGNFNNLFMLRVRETATAELLTRQLPKVEVYATALMSGATD
SSDPHGNTAFTSNTQDRISSNSVPLIEPAHVVALPKGQCFALTEGGNLWKVRMPLPAPDP
DEAMPKDLQELAGYMRQHYVEAGDWWENQGIPGLQDKALPDDLLDDFKQMAAAEEAEA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaccgcatgcggtcgaggtcttgctgcggccagcggtggagctttataccgtg
gcggtctgcaccggcgccgcgattctgtgcctggtggcaccgtggtcgctcgcgctgaac
ccgctgctcggcctgggctcggcgctggccttcctgaccttcggcgcgattcgcctgcgc
gatgcctgggcgatcctgcgctatcgccgcaacatccgccgcctgccgcgctacgtgatg
accagccgcgacgtgccggtgagtcagcaacggctgttcgtcggccagggctttcgctgg
gaacagcggcacacgcaccggctgatgcagacctatcggccggagttccgccgctacgtc
gagccgacggcgatctaccgggccgcccggcggctggaggagcggcttgagttcgcgccg
tttcccgtctcgacgctggcgcgcgcgttggcctgggacagcccgctcaacccggcgcga
ccactgccgtcggtcggcggactgccacgcctgcatggcatcgaacctgccgaggtcgac
gtcaccctgccgctgggcgagcgcgtcggccacaccctggtgctgggcaccacgcgcgtg
ggcaagacgcggctggccgagctgttcatcacccaggacatccgccgcaaggtccgcggc
gagcacgaggtggtgatcgtcttcgaccccaagggcgatgcggacctgttgaagcgcatg
tacgtcgaggccaagcgcgccgggcgcgaaggcgagttctacgtcttccatctgggctgg
ccggacatctcggcgcgctacaacgccgtgggccggttcgggcggatctccgaggtggcc
acgcggatcgccgggcagctctccggcgaaggcaacagcgccgcgttccgcgaattcgcc
tggcgcttcgtcaacatcatcgcgcgcgccctggtcgagctggggcagcggccggactac
ctgctgatccagcgccacgtcatcaacatcgacgcgctgttcatcgagtacgcccagcac
tacttcgccaagaacgagccgaaggcctgggaggtcatcgtccagctcgaagcgaagctg
aacgagaagaacatcccgcgcaacatgatcgggcgcgagaagcgcgtggtggccctcgaa
cagtacctgtcccaagtgcgcatctatgacccggtgctcgacggcctgcgcagcgccgtg
cgctacgaccggacctacttcgacaagatcgtcgcttcgctgctgccgctgctggagaag
ctcaccaccggcaagatcgcgcaactgctcgcaccgaactattccgacctgtccgacccg
cggccgatcttcgactggatgcaggtcatccgcaaacgcgcggtggtctacgtggggctg
gatgcgctgtccgacgccgaagtcgcggcggcggtgggcaactcgatgttcagcgatctg
gtctcggtcgccggccacatctacaagttcggcgtcgacgacgggctgcccggcgccgcg
gcgggcgccaagattccgatcaacgtccacgccgacgaattcaacgaactcatgggcgac
gagttcattccgatggtcaacaagggcggcggtgccggcgtgcaggtgacggcctacacg
cagaccttgagcgacatcgaggcccgcatcggcaatcgtgccaaggccggccaggtggtc
ggcaacttcaacaacctgttcatgctgcgcgtgcgcgagaccgccaccgccgagctgctg
acgcgacaactgcccaaggtcgaggtgtacgccacggcgctgatgagcggcgccaccgac
agctccgatccgcacggcaataccgcgttcacgtccaacacccaggaccgcatcagcagc
aacagcgtgccgttgatcgagccggcgcatgtggtggcgctgcccaaggggcagtgcttc
gcgctgaccgagggcggcaacctctggaaagtccgcatgccgctgcctgcgcccgacccc
gacgaagccatgccgaaggatctgcaggagctggccggctacatgcggcagcactacgtc
gaggcaggagactggtgggagaaccaaggcatccccggcctgcaggacaaggcgctgccc
gacgacctgctggacgacttcaagcagatggccgcggctgaagaggccgaagcatga

DBGET integrated database retrieval system