KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1309Help
Entry
PSTAB_1309        CDS       T01571                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00260  Glycine, serine and threonine metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAB_1309
Enzymes [BR:psz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PSTAB_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEJ04590
UniProt: F8H3H5
Position
1365998..1367014
Genome map
AA seq 338 aa AA seqDB search
MTIIDLRSDTVTQPSSAMREVMCCAATGDDVYSEDPTVSLLESRLAASLGFTAGLFVPSG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIEMEADGTLDLARVEA
AIKPDNFHFARSRLLTLENTMQGKVLPLDYLAAARDLTRRHGLALHLDGARLFNAAVRLG
CDAQEITRHFDTVSVCLSKGLGAPVGSVLCGGEAFIGKARRLRKMVGGGMRQAGVLAAAG
LYALEHNVARLAEDHRRAQWLGKELAALGFAVEPVQTNMVYVAMGDRASALAEFCSTRGI
RLTPSARLRLVTHLDVHDEHLPMVVHAFAEFAGNMSGN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcatcgatcttcgcagcgacaccgtcactcagccctccagcgcaatgcgtgaa
gtgatgtgttgtgctgcgaccggtgatgacgtgtacagcgaggacccgacggtcagcctg
ctcgagagccgcctcgccgcgagtctggggtttaccgcagggctcttcgttccttcgggg
accatgagcaatctgctggggctgatggcgcactgcgagcggggtgacgagtacatcgtt
ggccagcaggcgcacacctacaaatacgaaggcggcggagcggcggtgctgggctcgatt
cagccgcagccgatcgaaatggaggcggacggcacgctggaccttgcccgcgtcgaagcg
gcgatcaagccggacaacttccacttcgcccgtagccgtctgctgacgctggaaaacacc
atgcagggcaaggtgctgccgctggactatcttgccgcggctcgcgacctcacgcgccgg
cacggcctggcgctgcatctggatggtgcccggctgttcaatgcggcggtaaggctcggt
tgcgatgcccaagagatcacccggcatttcgatacggtttcggtgtgtctgtccaagggg
ctcggtgcgccggtggggtcggtgctctgcggtggcgaggcattcatcggcaaggcgcgg
cgcctgcgcaagatggtcggcggtggcatgcgccaggctggcgtgctcgccgccgccggg
ctctacgcgctggagcacaatgtcgctcggctcgccgaggatcatcgtcgcgcccagtgg
ctcggaaaggagctggccgcgcttgggttcgcggtcgagcccgtgcaaaccaacatggtt
tatgtggcgatgggtgacagggcttcggcattggcggagttctgttcgacgcgtggcatc
cggctgaccccttcggcacggctgcgtctggtgacccatctcgacgtgcacgacgagcac
ctgccgatggtggtacatgccttcgccgaattcgccgggaacatgagcggcaattga

DBGET integrated database retrieval system