KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1620Help
Entry
PSTAB_1620        CDS       T01571                                 

Gene name
faoA
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00071  Fatty acid degradation
psz00280  Valine, leucine and isoleucine degradation
psz00281  Geraniol degradation
psz00310  Lysine degradation
psz00362  Benzoate degradation
psz00380  Tryptophan metabolism
psz00410  beta-Alanine metabolism
psz00640  Propanoate metabolism
psz00650  Butanoate metabolism
psz00903  Limonene and pinene degradation
psz00930  Caprolactam degradation
psz01040  Biosynthesis of unsaturated fatty acids
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
psz01212  Fatty acid metabolism
Module
psz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSTAB_1620 (faoA)
   00650 Butanoate metabolism
    PSTAB_1620 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_1620 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    PSTAB_1620 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAB_1620 (faoA)
   00310 Lysine degradation
    PSTAB_1620 (faoA)
   00380 Tryptophan metabolism
    PSTAB_1620 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSTAB_1620 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSTAB_1620 (faoA)
   00281 Geraniol degradation
    PSTAB_1620 (faoA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTAB_1620 (faoA)
   00930 Caprolactam degradation
    PSTAB_1620 (faoA)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSTAB_1620 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSTAB_1620 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSTAB_1620 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PSTAB_1620 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEJ04901
UniProt: F8H745
Position
1697253..1699400
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNDLRQAVDAIKADASVKGVIVTS
GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLGVPTVVAINGIALGGGFE
MCMAADYRVMSTTAKVGLPEVKLGIYPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDAL
KVHAVDAVVAPEKLQEAALDLVKRAISGELDYKAKRQPKLDKLKLNAIEQMMAFETSKAF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSVAESLVGLFLSDQEL
KKKAKAYDKQARDVKLAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEGIQMGLDEASKL
LGKRVEKGRLTADKMAQALNAIRPTMSYGDFGTVDIVVEAVVENPKVKHAVLAEVEGHVR
EDAIIASNTSTISISYLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTSETAIATTVA
YAKKMGKSPVVVNDCPGFLVNRVLFPYFGGFARAIAHGVDFVRADKVMEKFGWPMGPAYL
MDVVGMDTGHHGRDVMAEGFPDRMKDDTRTAVDVMYDANRLGQKNGKGFYAYEMDKKGKP
KKVVDPQAYELLKPIVAETRELSDEDIINYMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVAMADKYADLGPLYHPTAKLREMAANGQRFYG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaataaattcaatcgcctcactctcaacgatctg
cgccaggctgtcgatgccatcaaggccgacgcttcggtcaagggcgtgatcgtcaccagc
ggcaaggatgtgttcatcgtcggtgccgacatcaccgagttcgtcgacaacttcaagttg
cccgatgaagagctggttgccggcaacctcgaagcgaacaagatcttcagcgatttcgaa
gacctgggcgtacccaccgtggtcgccatcaacggcatcgccctgggtggcggtttcgag
atgtgcatggctgccgactatcgcgtcatgtccaccaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggtactgtgcgtctgccgcgcctgatcggt
gtggacaacgccgtcgagtggatcgcctccggcaaggaaaaccgtgccgaagacgccctc
aaggtgcacgcggtcgatgccgtcgtcgctccggagaaactgcaggaagctgccctggac
ctggtcaagcgcgccatctccggcgagctggactacaaggccaagcgtcagccgaagctg
gacaagctcaagctcaacgccatcgagcagatgatggccttcgaaaccagcaaggccttc
gtggctggccaggccggcccgaactacccggccccggtcgaagccatcaagaccattcag
aaagccgccaacttcggccgtgacaaggcgctagaagtcgaggctgctggcttcgtcaag
ctggccaagacctcggttgccgaaagcctggtcggcctgttcctcagcgatcaggaactg
aagaagaaggccaaggcctacgacaagcaggcccgcgacgtgaaactggctgccgtactc
ggcgccggcatcatgggtggcggcatcgcctaccagtcggccgtcaagggcacgccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctggacgaagcctccaagctg
ctcggcaagcgtgtcgagaaaggccgtctgaccgctgacaagatggcgcaggcgctcaac
gcgatccgcccgaccatgtcctatggcgatttcggcaccgtcgacatcgtcgtcgaagcc
gtggtcgagaacccgaaggtcaagcacgccgtgctggccgaggtggaagggcacgtacgc
gaggacgcgatcatcgcctccaacacctccaccatctccatcagctacctggcccaggcg
ctcaagcgtccggaaaacttctgcggcatgcacttcttcaacccggtgcacatgatgccg
ctggttgaggtgatccgcggcgagaagaccagcgaaaccgccatcgccaccaccgtcgcc
tacgccaagaaaatgggcaagagtccggtcgtggtcaacgactgcccgggcttcctcgtc
aaccgcgtgctgttcccgtacttcggcggcttcgctcgcgccatcgcccacggtgtcgac
ttcgttcgtgccgacaaggtgatggagaagttcggttggcccatgggcccggcctacctg
atggacgtcgtcggcatggacaccggccaccacggccgtgacgtgatggccgaaggcttc
ccggatcgcatgaaggacgatacccgcaccgccgtcgacgtcatgtacgacgccaaccgc
ctcggtcagaagaacggcaagggcttctatgcctacgagatggacaagaagggcaagccg
aagaaggtcgtcgacccgcaggcctacgagctgctcaagccgatcgtcgccgagacgcgc
gagctgtccgacgaggacatcatcaactacatgatgatcccgctgtgcctggaaaccgtg
cgctgcctggaagacggcatcgtcgagaccgctgccgaagccgacatgggcctgatctat
ggcattggcttcccacccttccgtggtggtgcgctgcgctacatcgattcgatcggcgtc
gccgagttcgtcgcgatggccgacaagtacgccgacctgggcccgctgtaccacccgacc
gcgaagctgcgcgagatggctgccaacggccagcgcttctacggttaa

DBGET integrated database retrieval system