KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1811Help
Entry
PSTAB_1811        CDS       T01571                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00071  Fatty acid degradation
psz00072  Synthesis and degradation of ketone bodies
psz00280  Valine, leucine and isoleucine degradation
psz00310  Lysine degradation
psz00362  Benzoate degradation
psz00380  Tryptophan metabolism
psz00620  Pyruvate metabolism
psz00630  Glyoxylate and dicarboxylate metabolism
psz00640  Propanoate metabolism
psz00650  Butanoate metabolism
psz00900  Terpenoid backbone biosynthesis
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
psz01212  Fatty acid metabolism
psz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAB_1811
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAB_1811
   00640 Propanoate metabolism
    PSTAB_1811
   00650 Butanoate metabolism
    PSTAB_1811
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSTAB_1811
   00072 Synthesis and degradation of ketone bodies
    PSTAB_1811
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTAB_1811
   00310 Lysine degradation
    PSTAB_1811
   00380 Tryptophan metabolism
    PSTAB_1811
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTAB_1811
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTAB_1811
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSTAB_1811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psz04147]
    PSTAB_1811
Enzymes [BR:psz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSTAB_1811
Exosome [BR:psz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTAB_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEJ05092
UniProt: F8H8R9
Position
1903197..1904381
Genome map
AA seq 394 aa AA seqDB search
MKDDPIVIVSSARTPMGGFQGDLQGMTAWQLGAAAIRATVERSGLPAENVQDVLMGCVLP
AGQGQAPARQAALSAGLTRATTCTTVNKMCGSGMQTVIMAHDQLLAGSADIVVAGGMESM
SNAPYLLDRARGGYRMGHGRVLDHMFLDGLEDSFDKGRLMGTFAEECADTFGFSREEQDG
YALESLRRAQSAIAEGRFAEEIVTLEVTQGKQQRQIRDDEQPPKAMPEKIPSLKPAFREG
GTVTAANSSSISDGAAALLLMRRSEAERWGLQPQAVIHGHAAYADAPNLFTTAPIGAIRK
LMQRTGWAVEEVDLFEINEAFAVVAMAAMRELGLDPAKVNVNGGACALGHPIGASGARIL
VTLLSALRARGLRRGVAAICIGGGEATAMAVELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgatccgatcgtaatcgtcagcagcgcacgcacgcccatgggcggctttcag
ggcgacctgcagggcatgaccgcctggcaactcggcgctgccgccatccgcgccacggtg
gaacgcagcgggctgccggccgagaacgtgcaggacgtgctgatgggctgtgtgctacct
gccggccaggggcaggcaccggcacggcaggcggcattgagcgccggactgacccgcgcc
actacctgcaccaccgtgaacaagatgtgcggctcgggcatgcagacggtgatcatggcc
cacgatcagctgctcgccggcagcgccgatatcgttgtcgctggcggcatggaaagcatg
agcaacgcaccgtacctgctcgaccgcgcccgcggcggctaccgcatgggccacggccgg
gtgctcgaccacatgttcctcgatggcttggaagattcgttcgacaaaggccggctgatg
ggcactttcgccgaggaatgcgccgacaccttcggcttcagccgcgaggagcaggacggc
tacgcgctggaatcgctgcgccgcgcccagtcggccatagccgaggggcgtttcgccgag
gagatcgtcacgctggaggtcacccagggcaaacagcagcggcagattcgtgacgacgag
cagccgcccaaggcgatgccggagaagattcccagcctcaaaccggccttccgcgagggc
ggcacggtgaccgcggccaattccagttcgatctccgacggcgccgctgcgctgctgctg
atgcgccgctccgaggccgagcgctggggcctgcagccgcaggcggtgatccacggtcac
gcggcctacgccgatgcgccgaatctgttcaccaccgcgccgatcggggcgatccgcaag
ctgatgcagcgcaccggttgggccgtcgaggaggtcgatctgttcgagatcaacgaggcc
ttcgccgtggttgccatggccgccatgcgcgagctgggcctggaccccgccaaggtaaac
gtcaacggtggcgcctgtgcgctcgggcatcccatcggtgcttcgggtgcgcgaatcctg
gtgacgctgctttcggctttgcgcgcccgtggcctgcgccgcggcgtggcggcgatctgc
atcggcggcggcgaagccaccgccatggccgtcgaactggtctga

DBGET integrated database retrieval system