KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2475
Entry
PSTAB_2475        CDS       T01571                                 

Definition
(GenBank) Putative uncharacterized protein ORF SG70
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: AEJ05756
UniProt: F8H284
Position
2671294..2671857
AA seq 187 aa
MSRRYALVLLACALAGPIQAREIPPPAYQVAAQRAGIPSTVLYAITLQESGIRLRGRLVP
WPWTLNVAGKAQRYATRAEACGGLRQALRRTPAKRIDAGLGQVNLGYHAERYAQPCDLLD
PYRNLAIAAEILREQHTPSDDWLLTIGRYHRPAGGEPAARYRRSVGQHLARILGASKLEI
TARRNLP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtcacgccgctacgcactcgtgctgttggcctgcgcactggcaggccccatccaggcg
cgggaaatcccgccgccggcctatcaagtcgctgcgcagcgcgccggtattccctcgacc
gtgctgtacgccatcacgttgcaagagagcggcatccgtttgcgtggccgtctggtgcca
tggccgtggacgctcaacgtagctggcaaggcgcagcgctacgccacccgtgctgaggct
tgcggcgggctgcgccaggcactcaggcgcacacccgccaagcgcattgacgccggtctc
ggccaggtcaatctcggctaccacgcggagcgttatgcgcagccctgcgacctgctcgac
ccctaccgcaacctcgccatcgccgccgaaattctgcgtgaacagcacaccccaagcgac
gactggctgctcaccatcggccgctaccaccgccccgctggcggcgaaccagccgcgcgc
taccgccgcagcgtcggccagcacctagcccgcatactgggtgcctccaagctggaaatc
accgcccgaaggaatctgccatga

DBGET integrated database retrieval system