KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2485
Entry
PSTAB_2485        CDS       T01571                                 

Definition
(GenBank) Putative uncharacterized protein ORF SG59
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: UPF0242 RNase_Y_N DIRP YabA Macoilin DUF2353 DUF4274 Exonuc_V_gamma ZapB
Other DBs
NCBI-ProteinID: AEJ05766
UniProt: F8H294
Position
2677843..2679258
AA seq 471 aa
MHSNGLLKWLMIPLALLLVFVGIKLFSGGNDVTSTPEEASRLTPDEAKALGIEGDTPRDT
VATLVAQVRQLRTELQTALGDNKVQREENQRLRQREGTIDRRIQSALDSERSQLHQDRQE
VSSERQKTQSLLQQLQQRLDGIGKDNPADLPVGLGLELGDGLAGDTLRWVEPEDRRDDGK
QRSGNAASFSFPSSFAPAQKTLETTASSAVDAGRRATGVPETTAVYTVPTNATLIGSISM
TALIGRVPIDGTVNDPYPFKVLIGRDNLTANGIDIPDVAGAVVSGTASGDWTLSCVRGQI
RSVTFVFDDGTIRTIPKDDERGGNRQQDSSNTQDSIGWISDPYGIPCVSGQRRSNAQQYL
GTQALITAAGAGVASLIDSDNGQAAYMSSDGSIGTVGIGSNEAMGRILAGGMQDMSAWVN
KLYGQAFAAVYVKPGAKVAVHLEEPLTIDYDPQGRRVDHRLGGLPHAQELD
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgcacagtaatggcctgctcaaatggttgatgatccccctggcgctactactggtgttc
gtcggcatcaagctgttctccggcggcaacgacgttaccagcacaccggaagaagcttcc
cggctcacgcccgatgaagccaaagcgctcggtatcgagggcgacaccccacgcgacacc
gtggcgacgttggtagcgcaagtccgtcagctacgcaccgagctgcagaccgcactcggc
gacaacaaggtccaacgcgaagaaaaccaacggctgcggcaacgcgaaggcaccatcgac
cggcgcatccagagcgcgctcgacagcgaacgcagccagttgcatcaggatcggcaggag
gtcagcagcgaacggcagaaaacccagagcctgcttcaacaactgcagcagcggctcgat
ggcatcggcaaagataaccccgccgatctaccggtcggtctaggccttgagctgggcgac
ggcctggctggcgataccctgcgctgggtagagccggaggatcggcgcgatgacggcaag
cagcgttccggcaatgccgccagcttcagctttcccagcagcttcgcgccggcgcagaag
acactcgaaaccaccgcaagctccgccgtcgatgccggccgccgcgcgactggtgtgccg
gagacgacagccgtctacaccgtgccgaccaacgcgaccctgattggctcgatctccatg
acggcactgatcggccgcgtaccgatcgacggaaccgtcaacgacccgtaccccttcaaa
gtcctgatcgggcgcgacaatctcaccgcgaacggcatcgacattcccgacgtggccggt
gcggtggtcagcggcacggcttcgggcgactggaccctctcctgcgtgcgcgggcagatc
cgttcggtcaccttcgtgttcgacgacggcaccatccgaaccatccccaaagacgacgaa
cgcggcggcaaccgccaacaggacagcagcaacacgcaggacagcataggttggatcagc
gacccatacggcatcccctgcgtcagtggccaacggcgcagcaatgcccagcagtacctg
ggtacccaggccctgatcaccgcggccggcgcgggcgtcgcctcgctgatcgactccgac
aacggccaggccgcctacatgagcagcgacggctccatcggcacggtcggcatcggctcg
aatgaggccatgggccgcatactcgctggtggcatgcaggacatgtccgcctgggtcaac
aagctctacggccaagcgttcgcagccgtctacgtcaagcccggcgccaaggtggccgtg
catctcgaagaacccctgaccatcgactacgacccgcaaggtcgccgcgtcgatcaccgc
cttggagggctgccccatgcgcaggaattggactga

DBGET integrated database retrieval system