KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2487
Entry
PSTAB_2487        CDS       T01571                                 
Name
(GenBank) Putative uncharacterized protein ORF SG57
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE P-loop_TraG T2SSE AAA_22 TrwB_AAD_bind AAA_16 AAA_7 AAA_10 AIG1 DUF4913
Other DBs
NCBI-ProteinID: AEJ05768
UniProt: F8H2T0
Position
2679658..2682525
AA seq 955 aa
MAWSLFKHRRQAEEPAPPADTWARHVADLRAHGIAEPGTAHTSRRPATQADEQALYDAAP
SFTDLLPWAEYLPQSQCMLLDDGTSVAAFYELLPVGTEGREPAWLLQVRDTLENVLQDAF
DELEDNPWVVQLYAQDDTNWDRYLDELRHYVQPRAQGTAFTEFYLRFFGHHLQAIAKPGG
LFEDNTVTQLPWRGQTRRTRLVVYRRVGQAPQRRGQSPEQALNRVCDRLVGGLAHAGVRA
RRLGAADIHAWLLRWFNPHPTQLGNSAKNRERFYALTRYPDEQEPGEIELASGTDFAQRL
FFGQPRSDAALGQWYFDGMPHRAIAVDRLRSPPTTGHITGETRKGDAINALFDQLPEDTI
QCLTLVITPQDVLEAHLNHLGRKSVGDTLASEQTRADVQQARSLIGSAHKLYRSALTFYL
RGRDEAELDARGLQLGNVLLGAGLQPVREEDEVAPLNTYLRWLPCVYDPALDKRQWYTQL
MFAQHAANLAPLWGRSQGTGHPGLTLFNRGGGTITFDPLNRLDRQMNAHLFLAGPTGSGK
SATLNNLLNQVTAIYRPRLFIVEAGNSFGLYGDFAARLGLTVHRVKLAPGSGVSLAPFAD
AHRLVETPCQVQTLDADALDEDDAANDGDEQRDVLGELEITARLMITGGEEREEARMTRA
DRSLVRQCILDAAERCVAEQRAVLTRDVRDALRERSRDTTLPEVRLARLMEMADAMDMFT
QGSDGDMFDRPGTPWPEADITIVDLATYAREGYNAQLSIAYISLINTVNNIAERDQFLGR
PIINVTDEGHIITKNPLLAPYIVKITKMWRKLGAWFWLATQNLDDLPKAAEPMLNMMEWW
LCMGMPPDEVEKIAKFRELTPAQKALMLSARKETGKFSEGVILSRSMELLFRAVPPSLYL
ALAQTEPEEKAERYQLMQQHGISELDAALKIAENIDRARGIAPLSMDWSILSKVR
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggcctggtccctgttcaagcaccggcgccaggccgaggaacccgcgccacctgcggac
acctgggcacgccatgtcgccgatctgcgcgctcacggcattgccgaacccggcaccgcg
cacacttcgcggcggccagccacccaggccgacgagcaagcgctctacgatgccgccccc
tcgttcaccgacctgctgccgtgggccgagtacctgccccagtcacaatgcatgctgctt
gatgacggcacctcggtagcggccttctacgagctgctcccggtcggcacggaaggacgc
gagcctgcctggctgttgcaggtccgcgacaccctggaaaacgtgctgcaggatgccttc
gacgagctggaggacaacccctgggtcgtgcagctctacgcgcaggacgacaccaactgg
gatcgctaccttgatgagctgcgccactacgtccagccccgcgcccaaggcaccgccttc
accgagttctacctgcggttctttggccaccatctgcaggccatcgccaagcccggcggt
ctgttcgaggacaataccgtcacccaattgccctggcgcgggcaaactcggcgcacgcgg
ctggtcgtctatcgccgtgtcggccaggcaccgcagcgccgtggacaatcgcccgagcag
gcgctcaatcgggtctgcgaccgcctcgtcggcggcctggcccatgctggcgtgcgcgcc
cggcgtctcggcgcggcggatatccacgcctggttgttgcgctggttcaatccccatcca
acccagctcggtaacagcgccaaaaaccgggagcgcttctatgccctgacccgctacccg
gacgaacaggagcctggcgagatcgagctggccagcggcaccgatttcgcacaacggctg
ttcttcggccagccgcgctcggatgccgccctgggccagtggtacttcgatggcatgcca
caccgcgccatcgccgtcgaccgcctgcgcagcccacccaccacagggcatatcaccggc
gaaacccgcaagggtgacgcaatcaatgcgctgttcgaccaactgccggaagacacgatt
cagtgcctgacgctggtcatcaccccgcaggatgtgctcgaagcgcacctcaaccacctt
ggccgcaaatccgtgggcgacaccttggcatcggaacagacccgtgccgatgtgcaacag
gcccgcagcctgatcggcagcgcccataagctgtaccgaagcgcactcaccttttacctg
cgcggccgcgacgaggcggaactggacgcacgcggcctgcaacttggcaacgtgctgctc
ggtgccgggctgcaaccggtacgcgaagaagatgaggtcgcaccgctcaacacctatctg
cgctggctgccctgcgtctacgaccctgcgctggacaagcgccagtggtacacccagctg
atgttcgcccaacacgccgccaacctggcaccgctgtgggggcgcagccagggcaccggc
caccccggtctcacattgttcaaccgcggcggcggcaccatcaccttcgatccgctcaat
cgcctcgatcggcaaatgaatgcgcacctgttcctcgccggcccgaccggctccggcaag
tcggccacgctcaacaatctgctcaaccaagtcaccgcgatctaccgaccaagactgttc
atcgtcgaagccggcaactcctttggcctgtacggcgatttcgccgcgcggctgggtctc
accgtgcatcgtgtgaaactcgcgcccggctcgggcgtcagcctcgccccgttcgccgat
gcgcaccggctggtggaaacgccctgccaggtgcaaacgctcgacgccgatgccttggat
gaagacgacgcagctaacgatggcgatgagcagcgcgacgtcctgggtgagctggagatc
accgcccgcctaatgatcacaggaggagaagaacgcgaggaagcgcgcatgacgcgtgct
gatcgcagcctggttcgccaatgcatcctcgacgcggcagagcgctgtgtcgccgagcaa
cgcgcggtgctcacgcgggacgttcgcgatgccctgcgcgagcgcagccgcgacacgact
ttacccgaggttcgccttgcacggctgatggaaatggccgatgccatggacatgttcacc
cagggcagcgatggcgatatgttcgaccgccccggcacgccctggccggaagccgacatc
accatcgtcgacctggctacctatgccagggagggctacaacgctcagctttccatcgcc
tatatctcgctgatcaacaccgtcaacaacatcgccgagcgcgaccagttcctgggccgt
ccgatcatcaacgtcaccgacgaggggcatatcatcaccaagaacccattactcgcgccc
tatatcgtcaaaatcaccaagatgtggcgcaaacttggggcctggttctggctggcaacg
cagaacctggacgacctgcccaaagccgccgagccaatgttgaacatgatggagtggtgg
ttgtgtatgggcatgccaccagacgaggtagagaaaatcgccaagttccgcgaactcact
ccggcgcagaaagccctgatgctctctgccagaaaggagaccggcaagttctcggaaggc
gtaatcctgtcgcgcagtatggagctgttgttccgcgcggtgccccctagcctctatctc
gcgctcgcccaaaccgagccggaggaaaaagccgagcgctaccaactcatgcaacagcat
ggcatcagcgaactcgacgccgcgctcaagattgccgagaacattgaccgggcgcgcggt
atcgccccgctgtcgatggactggagcatcctgagcaaggtccgttga

DBGET integrated database retrieval system