KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2905Help
Entry
PSTAB_2905        CDS       T01571                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
KEGG Orthology (KO) [BR:psz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSTAB_2905
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     PSTAB_2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEJ06186
UniProt: F8H7E0
Position
3103321..3105453
Genome map
AA seq 710 aa AA seqDB search
MKLKQSNLRVHLMMAASLFAITPLHASDRIITDKELSDESNTADWLAYGRTHSEQRFSPL
KDINVDNVSQLKPEWYSPLPDRSDMVGTPLVVDGVMYYVGEMNRTRAFDARTGKKLWEYD
PQVSKEILDNNMKKVFWKHNRGLSTYGDKLFIATWDGRLIAINRKDGKEVWQTRTFDHDQ
PLNITGHPKAFDGKVFVGNGGTELGPMRGYVTAYDAETGKQVWRFYIVPGNPADGFEDAA
QEMAAKTWSGRWWENGGGGNAWHGWTYDAKYNQLIFGTGNGGPWNIKVRSPEGGDNLFLC
SVVAVDADTGEYKWHVQTAPGDTWDYNSNMDIVLADLKIDGKDVDAVLHAPKNGFFYTID
RSNGKVLSAEKFADANWSTRYDLKEQRHIVADDARYPDGEKNIYPSAFGAHSWHAMSYNP
ELNLAFIPTNHLGNTFKDDGKNTKPGHKMASHKLYLGLTGWELTKDPHESRGSLQAWDPV
KNKRVWQVNQKSPWGGGTLTTAGNLVFQGEPDGLFKAYDARTGQELWSYDVGLGISAPPI
TYKLDGKQMVSLLVGPGGALASNFGGSGELGFESHGWKYGAHERRIMTFSLDGKAVVPEQ
PAPQLAKPIIDEKFEVDAEKAETGAGVYAENLCVGCHGAGAVAGMKAPDLRESPILLTGS
EKAFESVVRGGALLVNGMPKFPDLTDAELESIRHFVRRQAHDGVKSGGGH
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaacagtcaaacctaagggttcacctgatgatggccgcctcgctttttgcg
atcacgccgctgcatgcatcagacagaatcatcacagacaaggaattgtccgatgaatca
aacactgctgactggctggcttacgggcgcacacactccgaacaacggttcagcccgctc
aaggacatcaacgtagataatgtcagccaactcaaacctgaatggtattcgccgctacct
gaccgctcagatatggtcggaacgcccttggtggtcgatggcgtcatgtactatgtgggc
gaaatgaacagaacacgtgcgttcgatgcccgcacgggaaagaagctttgggaatacgat
ccgcaagtttccaaagagatcctcgacaacaatatgaagaaggtcttctggaagcataac
cggggactttcaacctacggcgacaagttgttcattgccacctgggacggccgcctgatt
gcaatcaaccgaaaggacggcaaggaagtctggcagacccgtacattcgatcacgaccag
ccgttgaatatcaccggccatcccaaggccttcgacggcaaggtattcgtcggcaatggc
ggcaccgaacttggtccgatgcgtgggtatgtaactgcctacgatgccgaaaccggcaaa
caggtctggcgtttctatatcgttcccggcaatcctgccgatggattcgaggatgccgct
caggagatggcggccaagacctggagtggccgctggtgggagaacggcggcggcggtaat
gcctggcacggctggacgtacgacgccaagtacaaccagctcatctttggtacaggtaac
ggcggcccctggaacatcaaggtgcgtagcccggagggtggcgacaacctgttcctgtgt
tctgtcgtggcggtcgatgcggatacgggcgaatacaagtggcatgtccagactgccccg
ggtgacacctgggactacaactcgaacatggacatcgtgctggccgatctgaaaatagac
ggcaaggatgttgacgccgtattgcacgcccccaaaaacggcttcttctatacgatcgac
cgttcgaacggcaaggtactgtccgcggagaaattcgccgatgccaactggtcaaccagg
tacgacctgaaagagcagcgccatatcgttgccgacgacgccaggtatcccgacggcgag
aagaatatctatccatcggcattcggtgcgcactcatggcacgcgatgtcctataacccc
gagctgaatcttgcctttatccccaccaaccatctaggcaacaccttcaaggacgacggt
aaaaatacgaagcctggccataagatggcgagccacaaactctacctggggctgaccggt
tgggaattgaccaaggacccgcacgagtcacggggctcgttgcaggcctgggacccggtc
aagaacaagcgcgtgtggcaagtaaatcagaagagtccttggggcggcggtaccttgacc
acggccggcaacctggttttccagggcgagcccgatggcctgttcaaggcttatgacgca
cgcaccggtcaagaactctggtcctatgacgtcggcctcggtatctccgcgccaccgatc
acttacaagttggatggcaagcagatggtttccctgctggtgggccctggtggtgcattg
gcttccaacttcggcggctcaggcgaactgggttttgaaagccatggctggaaatatggt
gcgcatgagcgccgcatcatgaccttctcgcttgacggaaaagcggtcgttccagaacag
ccggcgccgcaactcgccaaacccatcatcgatgagaagtttgaagtcgatgccgaaaag
gccgagacgggcgcgggtgtctatgcggaaaacctctgcgttggttgccacggcgccggg
gctgttgcgggcatgaaggcacccgatctgcgggagtcgccgatcttgctcacaggcagc
gaaaaagcgtttgagagcgtggtgcgcggtggagcattgctcgtcaatggcatgcccaag
ttcccggatctgaccgatgcagagctggaaagcattcgccatttcgtgcgcaggcaagca
cacgacggggtgaaatcgggcggcggccattag

DBGET integrated database retrieval system