KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3471Help
Entry
PSTAB_3471        CDS       T01571                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00010  Glycolysis / Gluconeogenesis
psz00052  Galactose metabolism
psz00500  Starch and sucrose metabolism
psz00520  Amino sugar and nucleotide sugar metabolism
psz00521  Streptomycin biosynthesis
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
Module
psz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAB_3471
   00052 Galactose metabolism
    PSTAB_3471
   00500 Starch and sucrose metabolism
    PSTAB_3471
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAB_3471
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAB_3471
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSTAB_3471
Enzymes [BR:psz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSTAB_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEJ06752
UniProt: F8H0B4
Position
complement(3740603..3741571)
Genome map
AA seq 322 aa AA seqDB search
MRLALVGDIGGTNARFALWRNARLEAVRVLATADFATPELAVEYYLASLGLAPGSVGAAC
LACAGPVKGEQFVFTNNHWRLGRRDFCGALQLDELLLINDFAAMALGMTRVAEAQRRIIC
NGVAETGAPALVIGPGTGLGVATLLPLAGGGWQALPGEGGHVDLPLADAYEAALWQQLFA
GLGHVRAEDVLSGGGLLLLYRALCLLHDQAPRLASPAEVTAAALAGDTLAAATLEQFCVW
LGRVAGNNVLTLGARAGVYIVGGVVPRFADFFAASGFARGFASKGCMSAYLADVPVWLVT
AEYPGLEGAGVALEQALACVPG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgctggtcggtgacatcggagggaccaacgcgcgcttcgcgctctggcgc
aacgcccggctggaagcggtgcgcgtgctggcgacggcggatttcgccacgcccgagctg
gcggtcgagtactacctggcgtcgctcggtcttgcgccgggcagcgtcggtgcggcctgc
ctggcctgtgccgggccggtcaagggcgagcagttcgtgttcaccaacaaccactggcgg
ttggggcgcagggatttctgtggtgccctgcagctagacgagctgctgctgatcaacgac
ttcgcggccatggcgctgggtatgacccgggtcgccgaagcgcagcggcgcatcatctgc
aatggggtcgcggagacgggcgcgccggcgctggtgatcgggcccggcaccgggcttggc
gtggccacgctgctgccgctggcaggcggcggctggcaggcgctgccgggagagggtggg
catgtcgacctgccgttggcggatgcctacgaggcggcgctgtggcagcagctgttcgcc
ggactcggccatgtgcgcgccgaggatgtgctcagtggcggcggcctgctgctgctgtac
cgcgcgctctgcctgctgcacgaccaggcgccgcggctggcatcgccggccgaggtcacg
gcggcagcgctggccggcgatacgctggccgcggcgaccctggaacagttctgcgtgtgg
ctcggtcgcgtggccggcaacaacgtgctgaccctgggcgcgcgcgcgggcgtgtatatc
gtcggtggtgtggtgccgcgctttgccgatttcttcgccgccagcggcttcgcccgtggc
tttgccagcaagggctgcatgagcgcttatctcgccgacgtgccggtgtggctggtgact
gcggaatatccggggctcgaaggtgccggagtggcgctggagcaggccctggcgtgcgtg
cccggctag

DBGET integrated database retrieval system