KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3641Help
Entry
PSTAB_3641        CDS       T01571                                 

Gene name
ubiD
Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00130  Ubiquinone and other terpenoid-quinone biosynthesis
psz00627  Aminobenzoate degradation
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PSTAB_3641 (ubiD)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSTAB_3641 (ubiD)
Enzymes [BR:psz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     PSTAB_3641 (ubiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEJ06922
UniProt: F8H1Q5
Position
complement(3923281..3923910)
Genome map
AA seq 209 aa AA seqDB search
MSGPERITLAMTGASGAQYGLRLLDCLIQEDREVHFLISKAAQLVMATETDVVLPAKPQA
MQAFLSEYTGAAAGQIRVFAKEDWMAPPASGSGAPTAMVVVPCSTGTLSAIATGACNNLI
ERAADVTLKERRQLILVPREAPYSSIHLENMLKLSNLGAVILPASPGFYHQPQSIDDLVD
FVVARILNLLNIPQDMLPRWGEHHIVSDD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaccggaacgcatcaccttggccatgaccggcgcctccggcgcgcagtacggt
ctgcgcctgctcgattgcctgatccaggaagaccgcgaggtgcacttcctgatttccaag
gccgcgcaactggtgatggccaccgagaccgacgtggtgctgccggccaagccgcaggcc
atgcaggccttcctctccgagtacaccggtgccgccgccgggcagatccgtgtgttcgcc
aaggaggattggatggcaccgccggcgtccggctccggcgcaccgacggcgatggtggtg
gtgccctgttccaccggcacgctgtcggcaatcgccaccggcgcctgcaacaacctgatc
gaacgcgccgccgacgtcaccctcaaggagcgccgccagctgattctggtgccacgcgag
gcgccctattcgagcattcatctggaaaacatgctcaagctgtcgaatctgggcgcggtg
atcctgccggcctcgcccggcttctatcaccagccgcaaagcatcgacgacctggtggat
ttcgtcgtcgcgcgcatcctcaacctgctcaacattccccaggacatgctgccgcgctgg
ggcgagcaccatatcgtcagcgacgactga

DBGET integrated database retrieval system