KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4076Help
Entry
PSTAB_4076        CDS       T01571                                 

Definition
(GenBank) ImpA domain-containing protein
  KO
K11910  type VI secretion system protein VasJ
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
KEGG Orthology (KO) [BR:psz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psz02044]
    PSTAB_4076
Secretion system [BR:psz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSTAB_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasJ ImpA_N
Motif
Other DBs
NCBI-ProteinID: AEJ07357
UniProt: F8H6N3
Position
4400619..4402181
Genome map
AA seq 520 aa AA seqDB search
MHASALSKHYLELARKPVNDSNFAGDDIRYSSEFELLEAELAKAGALHQTTGIDWQKVRE
GSETLLTSLSKDLRAAAWLTWSLFQRESFAGLQAGLSVLHYLCSNHWAELHPRKPRTRAA
AINWLLPRLEQTFSEDVPVGEQLALFRSLAEQLHALEQCLSGHLGEDAPLLLPLCRQLDG
MVKRASSGQSQPGTVGAAIAQVKQVASQVFAPGAPIENDKEALKAVRNLQEQARPLTAWW
LKQRTSDLRPLRLSRTLLWLSIDSLPEHNGEQVTALRGIPADKLANYRERFAQGLYADLL
VDLENSTARAPFWLDGQRLAWECLQELAAEQAMREVEIQLALFLQRLPRLEELRFHDGTP
FADAETRAWISGQVLPHVQPAATTRQEEPPASGSIQPSWELALQEALPLLRKEGLKPAVQ
QLKQGLARARGGRERFFWQLSLARLCYQAKKYELAKTQLEALDQQLEASGLGSWEPDLAL
EVLRLLHSCCELLPQNHAVRESKDEIYRRLCHLDLEVVLD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccagcgcactcagcaagcattatctggaacttgccagaaagccggtcaatgac
agcaatttcgctggcgatgatattcgctacagcagcgaattcgaattgctcgaggccgag
ctggccaaggccggagcgctacaccagaccactggcatcgactggcagaaggtccgcgag
ggcagcgagacgctgctcacctcgctgtccaaggacctgcgcgccgccgcctggctgacc
tggagcctgttccagcgtgagtcctttgccgggttgcaggccggcctgagcgttctgcac
tacctgtgcagcaatcactgggccgagctgcatccccgcaagccgcgcacgcgcgccgcc
gcgatcaactggctgctgccgcggctggaacagaccttttccgaagacgtcccggtcggc
gaacagctggcgctgttccgcagcctggccgagcaactgcatgcgctggagcagtgcctg
tccggtcatctcggcgaagatgctccattgctgctgccgctatgccgccagctcgacggc
atggtcaagcgcgccagctcggggcaatcgcaacccgggacggtcggcgcagccatcgcc
caggtgaaacaggtcgccagccaggtcttcgcccccggcgcgccgatcgagaatgacaag
gaagcgctcaaggcggtgcgcaacctgcaggagcaggcgcgtccgctcacagcctggtgg
ctgaagcagcgcaccagcgatttgcggccgctgcgcctgtcacgcacgctcctgtggctg
agcatcgacagcctgccggagcacaacggcgagcaggtcaccgccctgcgtgggatacct
gccgacaagctggccaactaccgcgaacgtttcgcccagggcctgtatgcggacctgctg
gtggacctggagaacagcaccgcgcgtgccccgttctggctggacggtcagcgcctggcc
tgggagtgcctgcaggagctggcggccgaacaggccatgcgcgaggtggagattcagctc
gcgttgttcctgcagcgcctgccgcgtctggaggagctgcgcttccacgacggcacgccg
ttcgccgacgccgaaacccgcgcctggatcagcggccaggtcctgccacatgtgcagcct
gctgccacaacgagacaggaagagccgcctgcttccggcagcatacagccgagctgggag
ctggcgttgcaggaagcgctgcccctgttgcgcaaggaaggcctcaaacccgccgtgcag
cagctcaaacagggccttgctcgcgcccgtggcggccgtgagcgatttttctggcaactg
agcctcgcccgcctgtgctaccaggccaagaaatacgagctggccaaaacccagctcgaa
gcactcgaccagcagctcgaggccagcggcctgggcagctgggaacccgatctcgccctc
gaggtactgcgcctgctgcacagctgttgcgagctgttgccgcagaaccacgccgtgcgt
gaaagcaaggatgagatttaccgcaggctgtgccacctcgatctcgaagtggtgctggac
taa

DBGET integrated database retrieval system