KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4078
Entry
PSTAB_4078        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSTAB_4078
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psz02044]
    PSTAB_4078
Secretion system [BR:psz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSTAB_4078
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEJ07359
UniProt: F8H6N5
Position
4402732..4404210
AA seq 492 aa
MTTSAAAVEHGNHLAEGGILDRIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNENEPV
KKAMVDRMIAEIDAKLSRQMDEILHHPQFQALESSWRGLKLLVDRTNFRENIKLELLNAS
KQDLLDDFEDSPEIVQSGLYKHIYTAEYGQFGGQPVGALIANYFFDPSAPDVKTMQYVAS
VASMSHAPFIAAAGPKFFGLESFTGLPDLKDLKDHFEGPQFTKWQSFREQEDARYVGLTV
PRFLLRNPYDPEDNPVKSFVYKENVAGSHEHYLWGNTAYAFASRLTDSFAKFRWCPNIIG
PQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMRKGSDNAAFFS
ANSAQKPKFFGNSEEGKTAELNYKLGTQLPYLFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQFVADQENPSSEVRSRRPLRAAQVNVSDVEGEPGWYRVSLSVRPHFKYMGAD
FTLSLVGKLDKE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaccactagcgcagccgccgtcgagcacggcaatcacctcgccgaaggcggcattctc
gaccgcatcatcgccgaaacccgcctgaccccggacgacgaggcctacgacatcgccaag
cgcggcgtatcggccttcatcgaggaactgctcaagccgcagaacgaaaacgagccggtg
aagaaggcaatggtcgaccgcatgatcgcggagatcgacgccaagctcagccggcagatg
gacgaaatccttcaccacccacagttccaggcgctggagtcctcctggcgtggcctgaag
ctgctggtggatcgcacgaactttcgcgaaaacatcaagctcgaactgctcaacgcctcc
aagcaagacctgctggacgacttcgaggacagccctgaaatcgtccagtccggcctgtac
aagcacatctacacggccgagtacggccagttcggtggccagccggtcggtgcgctgatc
gccaactacttcttcgatcccagcgcgcccgacgtcaagaccatgcagtacgtcgccagc
gtcgcgagcatgtcccatgcgccgttcatcgccgctgccggcccgaaattcttcggcctg
gaaagcttcaccggcctgccggaccttaaggacctcaaggatcacttcgagggcccgcag
ttcaccaaatggcagagcttccgcgaacaagaagatgcccgctatgtcggcctgaccgtc
ccgcggttcctactgcgcaatccgtacgatccggaagacaacccggtgaagagcttcgtc
tacaaggaaaacgtcgccggcagccacgagcactacctgtggggcaacaccgcctacgcc
ttcgccagccggctgaccgacagcttcgccaagttccgctggtgcccgaacatcatcggg
ccgcagagcggcggcgcagtggaagacctgccgctgcaccatttcgaaagcatgggcgag
atcgagaccaagatcccgaccgaggtgctggtttccgaccgtcgcgagtacgagctggcc
gaggaaggctttatcgccctgaccatgcgcaagggcagcgacaacgccgccttcttctcc
gccaactcggcgcagaagccgaagttcttcggcaacagtgaggaaggcaagaccgccgaa
ctgaactacaagctcggcacccagctgccctacctgttcatcgtcaaccgcctggcgcac
tacctgaaggtgctgcagcgcgagcagatcggtgcatggaaggagcgcaccgacctcgaa
ctggaactgaacaagtggatccgccagttcgtcgccgaccaggagaatccgagctccgaa
gtacgcagccgtcgtccgctgcgcgccgcccaagtcaacgtcagcgacgtcgagggcgaa
ccgggctggtatcgcgtcagcctcagcgtgcgtccgcacttcaagtacatgggcgcggat
ttcaccctgtcgctggttggcaagctggacaaggaataa

DBGET integrated database retrieval system