KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4083
Entry
PSTAB_4083        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
KEGG Orthology (KO) [BR:psz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psz02044]
    PSTAB_4083
Secretion system [BR:psz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSTAB_4083
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEJ07364
UniProt: F8H6P0
Position
4407604..4409394
AA seq 596 aa
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLD
DELPELTHSLMHLLWPNYMRPLPAFSMLQFDPLKRPGPALTVPRNTPVESNPVQGVSCCF
RTAYATEVLPLALQALEYSVKGTGALLSLRLQMSADGNLGEIGLSHLRLHLAGEPYISQL
LYLSLLRHLGGIELVLLNEQGHPLTGPDGRPLTPLQLTAKQVEPVGFTEDEALIPYPLNT
FRGYRYLQEYFAFPDKFLFVDLKGLEIIQRIPEDLLKQARGLELRFDIHKAGVQRIRPTL
DNVRLYCTPVVNLFPHDAIPIRLDGKQDQYLLLPAEYDAQQCGVFSVDRVTGWKPGGMGY
EEYVPFESFEHDPSFDVPVARPHYSVRQQPSLLGEGQETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLKLGDICKPCEDTPEFLSFRNISAVTPSYAPPLQRDYLWKLISNMSLNYLSL
ANVEALKVILETYDLPRYYDKHADNVSRRRLGGLTHIAHQHVDRLHRGLPVRGVRTELTM
NQDGFIGEGDLFLFASVLNEFLALYASLNSYHELRVQSTQGEVYQWTPRMGQQPLL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgtctttcaaccattactaccagagcgagctcaccgccctgcgccagctgggcaagcgc
ttcgccgagcgcagcccggcgctcgcgccgttcctcggccaggccgggcgcgatccggat
gtcgagcggctgctcgaaggcttcgcttttctcaccgggcggctgcggcagaagctcgat
gacgagctgccggagctgacccactcgctgatgcatctgctgtggccgaactacatgcgt
ccgctgccagccttcagcatgctgcagttcgatccgctgaagcgccccggccctgcactg
acggtgccgcgcaatacgccagtggaatccaatcctgtgcagggcgtcagctgctgcttt
cgtaccgcctacgccaccgaggtgctgcctctggcattgcaggcgctggagtattcggtc
aagggcaccggtgcgctgctcagcctgcgcctgcagatgagcgccgatggcaatctcggc
gagatcggcctcagccatctccgcctgcacctggcgggcgagccctatatcagccagctg
ctctacctcagcctgttgcggcatctgggcggcatcgagctcgtgctgctgaacgaacag
ggccacccgctgaccggtcccgatggccgaccgctgacgcccttgcagctcaccgccaag
caggtcgaaccggtgggattcaccgaggatgaggcgctgatcccctacccgctcaatacc
ttccgcggttatcgctacctgcaggaatatttcgccttccccgacaagtttctcttcgtc
gacctaaagggccttgagatcattcagcgcattccggaggatctgctcaagcaggcccgc
ggcctggagctgcgcttcgacattcacaaggccggcgtgcaacgcatccgcccgacgctg
gacaacgtgcgcctgtactgtacgccggtggtaaacctgttcccgcacgatgccatcccg
atccgcctggacggcaagcaggaccagtacctgctgctgccggccgagtacgatgcgcag
caatgcggcgtgttttcggtggatcgggtcaccggctggaaacccggcggcatgggctac
gaagagtacgtgccgttcgaatccttcgagcatgaccccagcttcgatgtgccggtggcg
cgcccgcactacagcgtgcgccagcaaccttcgctgctgggcgaaggccaggaaacctgg
ctcagcttcggcctgcgcaacctcgaccagcacgagacgctgtccatcgagctgacctgc
accaaccagaacctgccgcgccagctgaagctcggcgacatctgcaagccctgcgaagac
accccggaatttctcagcttccgcaatatctcggcggtcaccccgagctacgcgccgccg
ctgcagcgcgactatctgtggaagctgatcagcaacatgtcgctgaactacctgtcgctg
gccaacgtcgaggcgctcaaggtgatcctcgagacctacgacctaccacgctattacgac
aagcacgccgacaacgtcagccggcggcgcctcggcggcctgactcacatcgcccaccag
cacgtcgatcgcctgcatcgcgggctgccggtgcgtggcgtacgtaccgaactgaccatg
aatcaggacggcttcattggtgagggcgatctgttcctcttcgcctcggtgctcaacgaa
ttcttagccctctacgccagcctcaactcgtatcacgagctgcgcgtgcagagcacacag
ggagaggtgtaccaatggacgccgcgcatgggtcagcaaccgctgctctga

DBGET integrated database retrieval system