KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4087
Entry
PSTAB_4087        CDS       T01571                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSTAB_4087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psz02044]
    PSTAB_4087
Secretion system [BR:psz02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSTAB_4087
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AEJ07368
UniProt: F8H6P4
Position
4414502..4416601
AA seq 699 aa
MFNPANQAHFTLSLEGVEHDFKVLEFRGREAISQPYRFDLELVSERPDLDLQSLLHRPAF
LAFAPDGSGVHGLVHQAAQGESGKRLTRYRLTLVPQLAYLAHRTNQRIFQHLTVPQIIAQ
VLEEHGIQADAYRFGLGPVVYPPREYCVQYDETDLHFIQRLCEEEGIHYHFQHAASGHVL
VFGDDQTVFPRLTATAYQRDSGLVADQPVIKRFGLRVETRTSRVTRRDYDFEKPRLTMEA
AFHSDFQPDLEDYDYPGRFTERARGKHLSQRALERHRHDYELAEGESDQPKLVSGHFLPL
TEHPRSDWNQLWLLTEVLHEGKQPQVLEEAVTSHVDSGDGFVQGYRNRFSATPWAIPFRP
ALRHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVKVQFYWDREAQADDKTSCWLRVSSSWA
GDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTVFKTLSSP
GGGGYNELRIEDRKGAEQIYLHAQRDWDENIEHDQKIRVGHERHDTVEANSYSEFRAEEH
RTTHADRKTEIRANDHLTVGNSQHLKIGTGKFIEAGNEIHYYAGSKVVIDAGMELTASGG
GSFLKLDPSGVTLSGATIRMNSGGAAGKGSGLKILAPVMPWLATSAVAGNLTLPALINMS
QQLKLAAAAKLLLVKQCGMRADGSCQLEVCPCGKNASTV
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgttcaacccagccaaccaggcccacttcacgctttccctcgaaggcgtcgagcacgac
ttcaaggtgctcgaattccggggccgtgaagccatcagccagccctatcgcttcgacctg
gaactggtcagcgagcgccccgacctggatctgcaaagcctgctgcatcgcccggctttt
cttgccttcgcgccggatggcagtggtgttcatgggctggtgcatcaggccgcccagggt
gaatccggcaagcgcctgacccgctatcgcctcacgctggtgccgcaactggcctacctc
gcccatcgcaccaaccagcgcatcttccagcacctgacggtgccgcagatcatcgcccag
gtgctcgaagagcatggtatccaagccgatgcctaccgcttcgggcttggcccggtggtc
tacccgccgcgcgagtactgcgtgcagtacgacgaaaccgacctgcacttcatccagcgc
ctgtgcgaggaagagggcatccactatcacttccagcacgctgcgagcggccatgtgctg
gtcttcggcgatgaccagaccgtcttccccaggctcaccgccaccgcctatcaacgggac
agcggtctggtcgccgaccaaccggtgatcaagcgcttcggcctgcgtgtggaaacccgt
accagccgggtcacgcgccgcgattacgatttcgagaagccacgcctgaccatggaggcc
gcgttccacagcgatttccagccggacctcgaggactacgactaccccggccgcttcacc
gagcgcgcccgcggcaagcatctgtcgcagcgcgccctggagcgccaccgccacgattac
gaactggccgaaggcgaaagcgaccagcccaagctggtgagtggccatttcctcccgctc
accgaacacccgcgcagcgactggaaccagctctggctacttaccgaagtgctgcacgaa
ggaaaacagccgcaggtgttggaggaggccgtcaccagtcatgtcgatagcggtgacggc
ttcgtccagggctaccgcaaccgcttcagcgccaccccctgggccatccccttccgcccg
gcgcttcgccatccgaaaccgaaggtgctcggcagccagaccgccgtggttaccggcccc
gctggcgaagagatccactgcgacgagtacggccgcgtaaaagtccagttctactgggac
cgcgaagcccaggccgatgacaagaccagctgctggctgcgcgtcagctccagctgggcg
ggtgaccgctatggcggcatcgccatcccgcgggtcggcatggaagtgctggtgaccttc
ctcgaaggcgatcccgatcaaccgctggtgaccggctgcctgtaccacaaggagcatcag
gtcccctacgacctgccggccaacaagacccgcacggtgttcaagaccctgagcagcccg
ggtggtggcggctacaacgaactgcgcatcgaagaccgcaagggcgccgaacagatctac
ctccacgcccagcgcgactgggacgagaacatcgagcacgaccagaagatccgcgtcggc
cacgaacgccacgacacggtggaagccaacagctacagcgagttccgcgccgaagaacac
cgcaccacccacgccgaccgcaagaccgaaatccgcgccaacgaccacctcaccgtgggc
aacagccagcacctgaagatcggcaccggaaaattcatagaggcgggcaatgaaatccac
tactacgccggcagcaaggtcgtcatcgacgcaggaatggaactcaccgcctcaggcggc
ggcagtttcctcaagctcgaccccagcggggtgacgctgagcggtgcgacgatccggatg
aattcgggtggcgcagccggaaagggctcggggctgaagattctggcgccggtgatgcca
tggttggcgaccagcgccgttgccggcaacctcaccttgcctgccttgatcaacatgtcg
cagcaactcaaactggccgcggccgccaagctgctgctggtcaagcaatgcggaatgcga
gccgatggctcatgccagttggaggtttgcccatgcggcaagaacgcgagcacggtctga

DBGET integrated database retrieval system