KEGG   Paenibacillus terrae: HPL003_00155Help
Entry
HPL003_00155      CDS       T01668                                 

Definition
(GenBank) uroporphyrin-iii c-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pta  Paenibacillus terrae
Pathway
pta00860  Porphyrin and chlorophyll metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPL003_00155
Enzymes [BR:pta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     HPL003_00155
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HPL003_00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase DUF4197
Motif
Other DBs
NCBI-ProteinID: AET56817
UniProt: G7VTD4
Position
complement(37342..38895)
Genome map
AA seq 517 aa AA seqDB search
MTGKVYLVGAGPGDARLITVKGWECIQLGDVIVYDRLASPRLLGLMKPGAQKIYVGKLPD
RHTMKQEEINQLLVDLALEGKTVVRLKGGDPTIFGRVGEEAGLLRKHGISYEIVPGITSA
ISVPAYAGIPVTHRDMASSLSIITGHESPDKLDKSIHWDKVTNATGTLIFMMGVAKIGYI
SEQLMKHGKSPSTPVALIRWGTRAEQDTLVGTLADIEAKVKAANFQPPAVIVVGEVVNQR
EQLKWAEDMPLFGKRILVTRARAQASSLVHRIEELGGEPYEFPVIQTVVPSDEPTQRQIK
EAFARLPEYDWVFFTSVNGVEYFFTHLKEQGKDVRSLFKARIAAVGPATLAALRSHGIEA
EQIEGPFQAEGLLEAFEQDLQAGQNVFLPRGDLARSWLPEKLRMLGLEVTEADLYQTVLA
ANTHDDELLKLLEERAIHAITFTSSSTVTFFLEALRQMEVEDPLSLLEGVTIAVIGPLTG
ETATQAGLTVSFMAEKATIESLIQSLCDWKQSSAVTS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaggtatatttagtaggcgcaggacccggtgacgcaagactgattacggtc
aagggctgggaatgcattcaactgggtgatgttattgtctatgacagactggcaagccct
cgccttttgggtttgatgaagccaggtgctcagaaaatatatgtaggcaagctaccggat
cgtcacaccatgaagcaagaggaaatcaatcagctgctggtggatctggctctggaagga
aaaacggtcgttcggctcaaaggcggggaccctaccatttttgggcgggtcggggaagaa
gccggactgctgcgcaaacacggtatttcctatgagatcgtacccggcattacatcagcg
atcagtgtacctgcctatgcgggcattccggtcacacaccgggatatggcctcatcgttg
tctatcattacggggcatgaaagtccggacaagctcgacaagagtattcattgggataaa
gtgacgaacgcaacgggcacactgatctttatgatgggtgtggcgaagatcggctatatc
agtgagcaactgatgaaacacggcaaatcgccaagcacacccgttgctttaatccgttgg
ggaacccgggcagagcaggatacgctggtgggtacgctggcagatattgaggccaaggtg
aaagcggcgaattttcagcctcccgccgttatcgtcgtcggagaagtggttaatcagcgt
gaacagttaaaatgggctgaggatatgcctttgttcggcaagcggattttggttacacgt
gcgcgtgcccaggccagtagtctggttcatcggatagaggagcttggtggagagccttat
gaatttccagtcatccagacggttgtcccttcggacgagccgacgcaacggcaaattaaa
gaggcgtttgcgcgattgcctgaatacgactgggtgttctttaccagcgtcaacggagtg
gaatattttttcactcatctgaaggaacaaggcaaggatgtgcgatcgctgtttaaggcg
cgtattgcagcagtcgggccagccactttggcggcattgcggtcacatggaattgaagcg
gagcagatcgaaggtccttttcaggcagagggcttgctcgaagcgtttgagcaggatttg
caggcagggcagaacgtatttctgccaagaggcgatctcgctcggtcctggctgccggag
aagctgagaatgcttggacttgaggtgaccgaggccgatctgtatcaaaccgtgctggcg
gcaaacacacatgatgatgagctgctcaagctgcttgaggaacgtgccatccatgcgatt
acttttactagttcctcaacagtaaccttttttctggaagcactcaggcagatggaagtc
gaagatccgctgtcgctgctggagggagtgacgatcgctgtgattggtcctctcaccgga
gaaacagcgacccaagcgggcctgaccgtcagcttcatggcggaaaaggcaactattgaa
agcctgattcaatcgctatgtgactggaaacaatcaagcgctgtgacatcataa

DBGET integrated database retrieval system