KEGG   Paenibacillus terrae: HPL003_00555Help
Entry
HPL003_00555      CDS       T01668                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00220  Arginine biosynthesis
pta00330  Arginine and proline metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01130  Biosynthesis of antibiotics
pta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    HPL003_00555
   00330 Arginine and proline metabolism
    HPL003_00555
Enzymes [BR:pta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPL003_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AET56895
UniProt: G7VU98
Position
121231..122145
Genome map
AA seq 304 aa AA seqDB search
MTKKTIRLLMPQWQGGYNPNYSFGAELLAWLAPDNDQPLIHVPVQAYDGTPLENENGMNG
RKQLLEQLEAAQHIIDAHKPDRIVIFGGDCLVEQAPFAYLNERYGGELGLIWIDAHSDLV
RYVGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLATPTEQEIEVISEAFQRL
GIAPTEPDTEVIQRLGIRTAGTQELTNSTESIREWIKESGIKHLAIHLDLDVLDPKAFRS
LLFANPEAPYHYSPAGTMQMPQLLHLIKELSEETDVVGLGITEHMPWDSINLKNLLGEIP
ILNK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacaatacgcctgttaatgccacaatggcaagggggatacaatcctaac
tactcttttggagccgaactgcttgcttggctagctccagacaatgatcaaccccttatt
catgttccagtgcaagcttatgatggaactccgctggaaaacgagaacggtatgaatggg
agaaaacagctacttgaacaattagaggctgcccagcatatcattgacgctcataagcca
gatcgcattgtaatttttggtggtgactgcttggtcgagcaagccccttttgcctattta
aacgaacgatacggtggggaattaggtttaatttggatcgatgctcacagtgatttagtt
agatatgtgggctatgataacggacatactttaccgctcggaaatctattgggagaagga
gatgaggagttcgcaaaacatgtgaaaatccctctaaaacctgaaaatgtctttatcgcg
ggattagcaacacctacagagcaagaaatagaagtgatttcagaagcgtttcaaagacta
ggtatagctccaacagaaccagatacagaagtcattcaaagacttgggattagaactgca
ggaacccaagagttaacgaacagtactgaatctataagagagtggattaaggaaagcggc
atcaagcacctggctattcatcttgatttagatgttcttgaccccaaggcatttcgttct
ttattattcgccaaccctgaagcaccttatcattattctcctgcaggaaccatgcaaatg
cctcaactgcttcatctgattaaagagctatctgaagaaacagatgtagttggattaggt
ataacggagcatatgccgtgggattctattaacttgaagaatctgcttggagaaatacct
attttaaataagtaa

DBGET integrated database retrieval system