KEGG   Paenibacillus terrae: HPL003_01730Help
Entry
HPL003_01730      CDS       T01668                                 

Definition
(GenBank) glycoside hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_01730
   00500 Starch and sucrose metabolism
    HPL003_01730
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HPL003_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AET57130
UniProt: G7VWR5
Position
complement(350690..352129)
Genome map
AA seq 479 aa AA seqDB search
MSSFVFPKDFLWGGALAANQVEGAFLEDGKGLSLVDLLPTGEKRRSIMQGNVPSLTPLEG
EFYPSHEAIDFYHRYREDIALFAEMGFKALRVSIAWARIFPTGEDATPNEAGLQFYDDLF
DELLKHGIQPVVTLAHFDVPVNLIDKYGSWRSRKLVALFETYAKTVLARYKDKVKYWMTF
NEINMLLHLPFIGAGLVFQEGENVKQIQYQAAHHQLVASALAVKACHEIIPDAKIGCMLA
AGSFYPYTCNPEDVYQGMEKDRESYFFIDVQSRGEYPGYAKRFFKDHGLSIEMEPEDAGI
LKHHTVDYIGFSYYSSRTTSTDPEVVKNMTSGNVFGSVSNPYLDKSDWGWTIDPKGFRIT
ANQLHDRYQKPLFVVENGLGANDVVSPEGEVNDDYRIDYLKRHIAEMGEALQDGVEIIGY
TSWGPIDIVSASSGEMKKRYGYIYVDRDNEGNGSLNRIKKKSFHWYKNVIHSDGENLGE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctttgtttttccgaaagactttttatggggtggtgctcttgctgccaatcag
gtcgagggtgcttttctggaagacggcaaaggattgagtctggtggatctgttgccgact
ggagaaaagagaagaagtatcatgcaggggaatgttccctcgctcactccgcttgaaggc
gaattctatccttcccacgaagcgattgatttttatcatcgctatcgcgaggatattgcg
ttatttgcggaaatgggtttcaaggcgctgcgtgtttccattgcctgggcccgtattttc
ccaacgggagaagacgccacgccgaatgaagccgggttacaattttacgatgatctgttc
gacgaattgcttaaacatggcatccagccagtggttaccctcgctcattttgacgtaccg
gtaaatctgattgataaatacggaagctggcgaagccgaaaattggtagctttgtttgaa
acatatgccaaaacagtattagcccgttacaaggataaagtgaaatactggatgacgttc
aacgaaattaacatgttgctccatttgccgtttattggtgccgggcttgttttccaagaa
ggtgaaaacgtcaagcaaattcagtaccaggctgcacatcaccagcttgttgcaagtgca
ctggctgtaaaagcgtgccacgagatcattccagacgccaagattggctgtatgctggct
gccggcagcttctatccatatacgtgtaatcccgaagatgtttatcaaggaatggaaaaa
gaccgcgagtcctacttcttcatcgacgtgcagtcacgcggggaatatcctggttatgcg
aagcgcttcttcaaggatcatggactctccatcgagatggaaccggaagacgcgggcatt
ttgaagcatcataccgttgactatatcggattcagttattattccagccggacgaccagc
acagacccggaagttgtcaaaaacatgaccagcggcaatgtgtttggctccgtatccaac
ccgtatctggacaagtccgattggggctggacgattgatccgaaggggttccgtatcacg
gcaaaccaattacacgaccgctaccaaaagcctctgtttgtggtggaaaacggccttggt
gccaacgacgtggtctctcctgaaggagaagtcaacgacgattaccggatcgactatttg
aagcggcatattgccgaaatgggcgaggctcttcaggatggggttgagattatcggttat
acgagttggggccctattgacatcgtcagcgcttcctcgggagagatgaaaaagcgctac
ggctatatttacgtggaccgggacaacgaaggcaacggctcactgaaccggattaaaaag
aaaagcttccactggtacaaaaacgtaattcattccgatggcgagaatctgggagagtaa

DBGET integrated database retrieval system