KEGG   Paenibacillus terrae: HPL003_10925Help
Entry
HPL003_10925      CDS       T01668                                 

Definition
(GenBank) O-glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pta  Paenibacillus terrae
Pathway
pta00511  Other glycan degradation
pta00600  Sphingolipid metabolism
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    HPL003_10925
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HPL003_10925
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     HPL003_10925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: AET58944
UniProt: G7VXA3
Position
complement(2367665..2369008)
Genome map
AA seq 447 aa AA seqDB search
MTIQTIQWFSTSKAKAWQSQSHHLSKTQEHANLTITGETHQLVEGFGGCFNELGYVALNH
LESDEREQVLHSLFHPEGEHKFTICRLPIGASDYALEWYSHNETDGDVEMKHYSIERDQQ
YLIPFIREALRLNPDLKLFASPWSPPTWMKSPKAYNYGTLRWEKDILKAYALYFVKFVQA
YREAGITIHQVHVQNEVIADQKFPSCVWTGEQLREFIRDYLGPAFEEHGLDTEIWLGTIN
APDPWEELMKKTSTGFDEYAHTVLSDPEAYKYIKGVGYQWAGKNAIQRTVASYPELRYMQ
TENECGNGENSWDYAKHVYNLYQHYFTNGVNAYIYWNMVLEPKGKSTWGWEQNSMITVDP
ADRKRTLNPEYYVMKHFSHFVLPGARRIGLRGSWTGNAVAFRNADGQTIVVIANPFHESR
VLNLSAGEDTHHFELEPESFNTIVIPS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcagaccattcagtggttttccacttccaaagcaaaagcttggcaatcccaa
tctcatcatcttagcaaaacccaagagcatgccaacctgaccattacgggggaaacgcat
cagctcgtcgaaggctttggtggctgttttaatgaactgggctatgtggccttgaaccat
ttggagagcgacgaacgggagcaggtgcttcattctctcttccacccggagggtgagcac
aaattcacaatttgccgactccctattggagccagtgactacgcgctggaatggtacagc
cacaatgaaacggatggcgacgtggagatgaagcattattccatcgagcgggatcagcag
tatctcattcctttcattcgggaagcgttacgacttaacccggacttgaaattgttcgct
tccccctggagcccgccgacatggatgaaatcgcccaaggcttacaattacggcacattg
cgctgggaaaaagatattttgaaagcgtatgcattatacttcgtcaaatttgtgcaggct
taccgcgaggcaggcattacgattcatcaggtccatgtccaaaatgaagtcattgccgat
cagaaattcccttcctgtgtatggaccggagaacaactgcgtgaatttattcgcgactac
ttgggccctgccttcgaggaacacgggctggatacggaaatttggctgggtaccattaat
gcccctgatccgtgggaagaattaatgaagaaaacgtccaccggattcgatgaatatgcc
cataccgtgctgagtgacccggaggcctacaaatatattaagggtgtgggctatcagtgg
gcaggcaaaaatgccatccagcgcaccgtagccagctatcctgagcttcgttacatgcag
accgaaaatgaatgcgggaacggagaaaattcctgggactacgccaaacatgtatataac
ctgtaccagcactacttcaccaatggcgtgaatgcttatatttactggaacatggttttg
gagccgaaaggcaagagcacatggggatgggagcaaaattcgatgatcaccgttgacccg
gcggatcgtaagcgtaccctgaacccggaatattacgtgatgaagcacttttctcatttt
gtattgccgggtgcgagacgcattggactccgtggatcatggacgggaaatgccgttgct
ttccgcaatgctgacggacaaacgatagtggtcattgccaatccgttccacgaatcacgt
gtgctgaatctgtccgctggagaggatacgcatcatttcgaactggagcctgaatctttt
aacaccatcgtcattccttcttaa

DBGET integrated database retrieval system