KEGG   Paenibacillus terrae: HPL003_14120Help
Entry
HPL003_14120      CDS       T01668                                 

Definition
(GenBank) acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pta  Paenibacillus terrae
Pathway
pta00071  Fatty acid degradation
pta00072  Synthesis and degradation of ketone bodies
pta00280  Valine, leucine and isoleucine degradation
pta00310  Lysine degradation
pta00362  Benzoate degradation
pta00380  Tryptophan metabolism
pta00620  Pyruvate metabolism
pta00630  Glyoxylate and dicarboxylate metabolism
pta00640  Propanoate metabolism
pta00650  Butanoate metabolism
pta00900  Terpenoid backbone biosynthesis
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
pta01212  Fatty acid metabolism
pta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPL003_14120
   00630 Glyoxylate and dicarboxylate metabolism
    HPL003_14120
   00640 Propanoate metabolism
    HPL003_14120
   00650 Butanoate metabolism
    HPL003_14120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPL003_14120
   00072 Synthesis and degradation of ketone bodies
    HPL003_14120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPL003_14120
   00310 Lysine degradation
    HPL003_14120
   00380 Tryptophan metabolism
    HPL003_14120
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPL003_14120
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPL003_14120
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPL003_14120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pta04147]
    HPL003_14120
Enzymes [BR:pta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPL003_14120
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPL003_14120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AET59575
UniProt: G7W0F4
Position
complement(3045587..3046771)
Genome map
AA seq 394 aa AA seqDB search
MKKVALVSPLRTAVGSFNKTLAPLSAPELGAIVMTACLQQSKLEPALIDQIYLGNVLQAG
NGQNPARQAALKAGIPIDVPESTINTVCGSGLHAVALAYNSILAEQSNIVLAGGMESMSN
APYLLRNARNGYKLGNGELVDSLVADGLTCPINHYHMGITAENVAEKYGISRLEQDEFAY
ESQIKAVEAKNKKVFEEQIVPVMIKTKKETIYFTEDEHIRGNTTKEKLSHLKTAFKENGT
VTAGNSSGINDGAAAMLVVSEDKCKEHALKPLAYIKGYSLVGVDPAYMGMGPVKAISSLL
KQQGISINDIDLFEINEAFAAQAVAVMKELGVNPEKVNVNGGAIAIGHPVGASGARILVT
LVHEMVRRSSRYGIASLCIGTGMGIAMLVENALI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctttagtaagcccgttgagaacagcggttggctcttttaacaaaacc
cttgcgcccctaagcgctcctgaactgggagcaattgtgatgacagcatgccttcagcaa
agtaaattagagcctgctttgattgatcaaatttatttgggaaatgttcttcaggcgggc
aatggccaaaatcctgccagacaggcggcactaaaagccggtatccccattgatgtaccc
gaatcaacgataaacacggtttgcggttcaggacttcatgccgtcgctttagcctacaat
tcaatattggcggaacaaagcaacatcgtcttggccggaggtatggagagcatgtcgaac
gccccttatctgctaaggaatgcaagaaacggctacaagcttggcaacggtgaattggta
gactccttggtggccgacggcctaacgtgcccgatcaaccattaccacatgggaattacc
gcagaaaatgttgccgagaaatatggaatttcaagacttgagcaagatgaatttgcctac
gaaagccagatcaaggctgtagaagcaaaaaacaaaaaggtttttgaagagcagattgtt
ccggtcatgattaaaaccaaaaaagaaacgatttatttcacagaggacgaacacataaga
ggaaatacaacgaaagaaaaactttctcatttaaaaactgcctttaaggagaacggaacg
gttaccgccggaaattcttcgggaattaatgatggcgcggcggctatgcttgtagtgtcg
gaagacaaatgtaaggaacatgcattaaagccgttggcatatatcaagggttattcactt
gttggcgttgaccctgcatatatgggaatgggaccagtaaaagccatttcgtcacttctt
aagcaacagggaatatccatcaatgacattgatctttttgaaattaatgaagcgttcgcc
gcacaagcagtagcggtaatgaaagagcttggggtcaatccggagaaggtgaatgtcaat
ggcggcgcgatcgcgatcgggcaccctgtcggtgcaagcggtgctaggatattggttacg
ttggttcatgaaatggtgcgaagatcttcacgttacggcatagcctcgttatgcatcgga
acgggaatgggaatagcgatgctggttgaaaatgcactcatttaa

DBGET integrated database retrieval system