KEGG   Paenibacillus terrae: HPL003_16965Help
Entry
HPL003_16965      CDS       T01668                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00030  Pentose phosphate pathway
pta00051  Fructose and mannose metabolism
pta00052  Galactose metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
pta01230  Biosynthesis of amino acids
pta03018  RNA degradation
Module
pta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pta_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_16965
   00030 Pentose phosphate pathway
    HPL003_16965
   00051 Fructose and mannose metabolism
    HPL003_16965
   00052 Galactose metabolism
    HPL003_16965
  Energy metabolism
   00680 Methane metabolism
    HPL003_16965
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HPL003_16965
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HPL003_16965
Protein phosphatases and associated proteins [BR:pta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HPL003_16965
Messenger RNA biogenesis [BR:pta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HPL003_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat ResIII
Motif
Other DBs
NCBI-ProteinID: AET60137
UniProt: G7W4I0
Position
3635632..3636603
Genome map
AA seq 323 aa AA seqDB search
MTAIKKIAVLTSGGDSQGMNAAVRAVVRSGLYFGLEVFGVQRGYQGLLNDDIFPMDLRSV
GDIIQRGGTVLQSARCKEFTTEEGQKRGAEILRNRGIDGVVVIGGDGSYQGANKLTKQGI
KTMCLPGTIDNDISFTDYTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIA
LHAGLASGAETILVPEVEFDLNEVSDRMKQNFKHGKRHSIIIVAEGAGKGETVAQVIQEN
CPDYEPRVTVLGHIQRGGTPTAFDRNLASRLGDFAVRQLIEGVSDKACGTIDGKLVATDI
DKVVNTKKEFNMELYELALRLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaattaagaaaatcgcagtattaacgagtggtggagattcacaggggatgaat
gccgcagttcgcgccgttgtgcgtagcggcttgtattttggacttgaagtattcggggtt
cagcgcggatatcaaggcctgctgaatgatgatattttcccgatggatttgagaagtgtt
ggagatattatccaacgtgggggtactgtacttcaatctgcaagatgcaaggaatttacg
accgaggaaggacagaagcgtggcgctgaaattttgcgtaaccgcggaattgatggtgta
gtcgtgatcggtggcgacggttcctatcaaggggctaacaaactgaccaagcaaggaatt
aaaaccatgtgtcttccgggtacgattgacaatgacatttccttcaccgactatacgatt
ggttttgacacggcggttagtatcgtagtggacgccatcaacaagctgcgtgatacgatg
tcatcccacgaacgttcttctatcgtagaagttatgggacgtcattgcggcgatattgct
ttgcatgcaggtctggcttccggcgcggaaacgattttggtacccgaggtagagtttgac
ctgaatgaagtatctgatcggatgaagcaaaactttaagcacggcaaacgccatagtatc
attattgttgctgaaggtgcaggtaaaggtgaaaccgtagcacaggtaatccaagaaaac
tgtccggactatgagccgcgtgttacggtgcttggacatatccagcgtggagggacacca
actgcatttgaccgtaatctggcgagccgtttgggtgactttgctgttcgtcaattgatt
gagggcgtatctgacaaggcttgtggaacgattgatggcaagctggtagccacagatatt
gacaaggtcgtaaatacgaaaaaagaattcaatatggagctttacgagctggccttgcgc
ttgtcccagtaa

DBGET integrated database retrieval system