KEGG   Paenibacillus terrae: HPL003_21845Help
Entry
HPL003_21845      CDS       T01668                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00052  Galactose metabolism
pta00500  Starch and sucrose metabolism
pta00520  Amino sugar and nucleotide sugar metabolism
pta00521  Streptomycin biosynthesis
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Module
pta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_21845
   00052 Galactose metabolism
    HPL003_21845
   00500 Starch and sucrose metabolism
    HPL003_21845
   00520 Amino sugar and nucleotide sugar metabolism
    HPL003_21845
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPL003_21845
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPL003_21845
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPL003_21845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-ProteinID: AET61097
UniProt: G7VQ28
Position
complement(4705343..4706263)
Genome map
AA seq 306 aa AA seqDB search
MSNSVIGVDIGGTNIRVGLVNEHLELVRKETALTSEFQSADEVFNYVKRVIEKVDHHKTV
DKIGIALPVPWKKRTEIICDATNIPCLEGVHTEFIKRFFPGYEVHFENDVNVVTLLESEH
GASQAYDQSIYITVSTGIGSGIVLNNEVLHGAHGYAGEIGSMVISDNDKSYSTLHPGTLE
ALCSGRALEKESQNLYGSEATAHLLFEKYKQHDEKAASVVNTWVEYFSNAIASLMQTIDP
DIFVIGGAVIHNNQWLIDKIIESAKTKVFEHLSDKVKVVLPKFGPDAGVIGAGYMALKNN
KGARTT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagcgtcattggagtagatattggaggaacgaatatacgagtcgggttagta
aatgagcatctggaattggtccgaaaagagacggcattaactagcgagttccaaagtgct
gatgaagttttcaactatgtcaagcgagtgatcgagaaagtggatcatcacaagacggtg
gacaagatagggattgccttgcctgttccttggaagaagcgaaccgagattatatgcgat
gcgaccaacattccctgcctggaaggggttcataccgaatttataaagcgctttttcccc
ggttatgaagttcattttgagaatgatgtaaatgtcgtgaccctgctggaatcagagcat
ggcgcttcccaggcgtatgatcaatcgatctatattacggtcagtacggggattggcagc
ggaatcgttctgaacaacgaggtgctccatggtgcgcatggctatgccggagagattggc
agcatggttatatctgataacgacaagagctattcgacattacatcccggcacgctcgaa
gctctgtgcagcggtagagccttggagaaagagagtcaaaatctgtacgggagcgaggct
acggcgcatttattgttcgagaaatacaagcagcatgacgagaaggcagcaagtgtcgtg
aatacctgggtcgagtatttctccaacgcgattgcttcattaatgcagacgatcgatcca
gatatatttgtcattggaggagcggtcattcacaacaaccaatggctgatagataaaatt
attgaaagcgctaaaaccaaagtatttgagcatttaagcgacaaagtcaaggtagtcttg
cctaaattcggccctgatgcaggagtgattggggcagggtacatggcgttaaaaaacaat
aaaggagcacgaacaacatga

DBGET integrated database retrieval system