KEGG   Paenibacillus terrae: HPL003_24620Help
Entry
HPL003_24620      CDS       T01668                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00620  Pyruvate metabolism
pta00640  Propanoate metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_24620
   00620 Pyruvate metabolism
    HPL003_24620
   00640 Propanoate metabolism
    HPL003_24620
  Energy metabolism
   00680 Methane metabolism
    HPL003_24620
Enzymes [BR:pta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPL003_24620
Lipid biosynthesis proteins [BR:pta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPL003_24620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AET61640
UniProt: G7VPB9
Position
complement(5336906..5338621)
Genome map
AA seq 571 aa AA seqDB search
MKIEELQAVVPTSNMGPYEQAYNRFQWEDAERHFTWYESGKVNMAHEAIDRHVEEGRGSK
TALLYCDANRHEAYTFSQLRASSNRFGNVLRKYGIGKGERVFIFMPRSPELVISLLGILK
VGAVVGPLFEAFMETAVKDRLEDSGAVALVTTPALLSRVKREELPELRHIFVVGDVDERE
QGIIDFETEMLTSSEELEPEWLSREDGLIIHYTSGSTGKPKGVYHVQNAMIQHYYTGKMV
LDLREDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPEDWYRTIERHEVTVWY
SAPTAFRMLMSAGEDIVDKYDLGSLRHVLSVGEPLNPEVVRWGWQVYKQRIHDTWWMTET
GGQMICNYPELPIKPGSMGKPLPGIQAAILDDRGQVLPPNRMGHLAIRTPWPSMMNRIWN
NPNKFQEYFRFSGWYVSGDSAYMDEDGYFWFQGRIDDVINSSGERIGPFEVESKLLEHPA
VAEAGVIGKPDTVRGEIIKAFIALREGYTPSEALQQDIYRFVKEGLSAHAAPREIEFKEK
LPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaagaactccaggctgtagttcccacatccaacatgggcccgtatgaacaa
gcttacaaccgctttcagtgggaagatgcagagcgtcattttacgtggtatgaatcaggc
aaagtgaacatggcgcatgaagcgattgaccggcatgtagaggaagggagaggcagcaaa
acggcgctgttgtattgtgacgcgaaccgccatgaagcctacaccttttctcagttgcgt
gccagctccaacaggtttggtaatgtgctgcgtaaatacggaattggcaaaggggagcgg
gtatttatattcatgccgcgttctcctgagctggtcattagcctgcttggcattttgaag
gtaggcgcggttgtcgggcctttatttgaggcatttatggaaacggcggtcaaggatcgg
ctggaagatagcggggcggtggcgctggtgacaacgcctgcacttctctcgcgcgtaaag
cgtgaggaacttccggagctgcggcatatttttgtagttggcgatgtggacgaacgggag
caagggattattgattttgaaacggaaatgcttacatcctccgaggaacttgaaccggaa
tggctgagtcgtgaagatgggttgattattcattacacgtcaggctcaacgggcaagcct
aaaggcgtgtatcatgtgcaaaacgcgatgattcagcactattataccggaaaaatggtg
ctggatctgcgtgaagatgatgtgtattggtgtacagccgatcccggttgggttacagga
acgtcatatggcatttttgccccatggctgaatggagcaacaaatgttattcgtggcggt
cgttttagccccgaggactggtaccgaaccattgagcgtcacgaggtgaccgtatggtat
agcgctcctacggcgtttcggatgctcatgagcgcaggggaggatatcgttgacaaatat
gatctcgggagcctgcggcatgtgctatccgtcggagagccgctaaatcccgaggtggtg
cgctggggctggcaggtatataagcagcgtattcatgatacctggtggatgacggaaacg
ggtggccaaatgatctgtaattaccctgagctgccgattaagcccggctcgatgggaaag
ccattgcctggcattcaggccgctattctggacgacagagggcaagtgctgccgcctaac
cgaatggggcatttggcgatacgtacgccgtggccgtctatgatgaaccgtatatggaac
aacccgaacaaatttcaggagtatttccgtttttccggctggtatgtgtccggtgattct
gcctatatggatgaggacggatacttctggtttcagggacgaattgatgatgtcattaac
tcgtccggggagcgaattggtccttttgaggtcgagagcaagcttctggagcatcccgct
gtagcggaggctggagtgatcggaaaaccggataccgtgcggggagagatcattaaagct
tttatcgcgcttcgtgaaggatatacaccttctgaagctttgcagcaggatatttatcgc
tttgtcaaagaagggctgtctgcccatgctgcaccacgtgaaattgagtttaaggaaaag
ctgcccaaaacccgttccggtaaaattatgagacgtgtactgaaagcttgggagcttaat
cttcctacaggagatttgtctaccatagaggattaa

DBGET integrated database retrieval system