KEGG   Paenibacillus terrae: HPL003_24920Help
Entry
HPL003_24920      CDS       T01668                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pta  Paenibacillus terrae
Pathway
pta00561  Glycerolipid metabolism
pta00640  Propanoate metabolism
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HPL003_24920 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HPL003_24920 (gldA)
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     HPL003_24920 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PFK Apc15p
Motif
Other DBs
NCBI-ProteinID: AET61700
UniProt: G7VPH9
Position
complement(5404476..5405579)
Genome map
AA seq 367 aa AA seqDB search
MSNVVRSVTSPKKFISGQNLLSSLNDYIKDYGDKAFVICDEFILERAQKEAGASIEAAGN
QAIFEKFQYECTKEEIERNRELVRKHGANIIIGIGGGKTLDTAKATAYYEKLPVVIFPTI
ASTDAPCTALAVIYKKDGSFDEYLFLPTNPDVVLADTGILAAAPARFFAAGIGDALATYF
EARACYQSNGDNLVLNKPSTTGLGLARLCYDTLLENAVKAKLAVDRKVYTRAVEDTIEAT
IYLSGVGAESGGLAAAHAIHNGMTAVPSLHKAQHGEKVTFGLLTQLVLENAPKEELETVI
KLVKDVGLPLTLRDLGVEEFVEAEWRQVAEAACASNDTMVNMPFPVSPADVYNAIIAANA
IAESYQG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgttgtaaggtccgttacttcacccaagaaatttatttctggccagaatctg
ctctcgtcgttaaatgactacattaaagattatggcgataaagcctttgttatttgcgat
gagtttatacttgaaagggcccaaaaggaggccggtgcttccattgaagcggctggcaat
caggcgattttcgagaaattccaatatgaatgtactaaagaagaaattgagcgtaaccgg
gagttggtgcgcaagcatggcgctaacatcattataggaataggcggcgggaaaacgctg
gataccgctaaggcaacggcttactatgaaaagctgcctgtcgttattttcccgacgatt
gcttctacggatgcaccttgtacagcccttgcggttatctacaagaaagatggctccttt
gatgaatatttgttcctgccaaccaatcccgacgttgtactcgcagatacgggtattctg
gcagcggcgcctgcacgtttcttcgcagctggcatcggcgatgccctggctacttatttt
gaagcgcgagcttgttatcagtccaatggggacaatctggtgctgaacaaaccttccacc
acagggttggggcttgcccgtctctgttatgatacgttgctggaaaatgccgtgaaagcc
aagcttgcggtggatcgtaaagtatatactcgcgcggtggaagataccattgaagcgaca
atttatctgagtggtgttggtgcggaatcaggcggtttggcagcagcgcatgcgattcat
aatggcatgacggctgttccttcactgcataaagcacagcatggcgagaaggttacattc
ggcttgctaactcagctcgtgctggaaaatgcaccgaaagaagaactggaaacggtcatc
aaactggttaaggacgtaggtcttccattgacgcttcgtgatctgggtgtagaggagttt
gtcgaggctgaatggcgtcaagtagctgaggctgcttgtgcatcgaatgacacgatggtc
aatatgccgtttccggtcagtcctgctgacgtgtacaacgccatcattgcggcgaatgcg
attgcagaatcctatcaaggatag

DBGET integrated database retrieval system