KEGG   Paenibacillus terrae: HPL003_26725Help
Entry
HPL003_26725      CDS       T01668                                 

Definition
(GenBank) Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pta  Paenibacillus terrae
Pathway
pta00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HPL003_26725
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HPL003_26725
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HPL003_26725
    1.1.1.-  
     HPL003_26725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AET62057
UniProt: G7VRN8
Position
5797256..5798308
Genome map
AA seq 350 aa AA seqDB search
MQALRWHGVKDLRLENIEQPAALAGKVKIKVEWCGICGSDLHEYVAGPIFIPQDAPHPLT
GEKAPIVMGHEFSGQVVEIGEGVTKIQVGDRVVVEPIFACGECAACKQGSYNLCDKMGFL
GLAGGGGGFSEYVAADEHMVHKIPESVSFEQGALVEPSAVALYAVRQSQLKVGDKAVVFG
AGPIGLLVIEALKASGASEIYAVELSEERKAKAEELGAIVIDPKTVDVVQELHKRTNGGV
DVAYEVTGVPPVLTQAIESTKISGQIMIVSIFEKEAPIKPNNIVMKERNLTGIIGYRDVF
PAVISLMEKGYFPADKLVTKRIKLEEVIEQGFEGLLKEKNQVKILVSPKA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgagatggcatggagtaaaagatttacgtttggaaaacattgagcaaccc
gctgctctggcaggaaaagtaaaaatcaaagtagaatggtgcggcatttgcggaagtgat
cttcatgaatatgtagcaggacctattttcattccccaagatgctcctcatcctttgact
ggagaaaaagcgccgatcgtcatgggacatgaattctctggacaagtagtcgaaatcggt
gaaggtgtaaccaaaattcaggttggcgaccgtgttgtcgtagaaccgatttttgcgtgt
ggagaatgtgctgcatgtaaacaaggcagctataatctttgcgataaaatgggcttcctc
ggtctggcaggcggcggcggtggattttctgaatatgtcgcagctgatgagcatatggta
cacaaaattccggaaagcgtatctttcgagcaaggcgctttggtagagccttcggccgtt
gctttgtatgctgttcgtcaaagccagctgaaagtcggcgacaaagccgtagtatttggc
gctggtcctatcggattgctggttattgaagctttgaaagcttcgggcgcatctgagatt
tatgcagtagaactttccgaggaacgtaaagctaaagctgaagagctgggtgctatcgtg
attgatcctaagacagttgatgttgtgcaagagctgcacaaacggactaacggcggcgta
gatgtagcctatgaagtcactggagtacctcctgtgctgactcaagctattgaatctact
aaaatcagcggacaaatcatgatcgtcagcatttttgaaaaagaagctccgatcaaaccg
aacaatattgtcatgaaggaacgcaatctgactggcattatcggctaccgtgatgtattc
ccggctgtaatcagcttgatggaaaaaggatatttccctgctgacaagctcgttaccaaa
cgtattaagctcgaagaagtgattgagcaaggttttgaaggtctgctgaaagaaaaaaat
caggttaaaatcctggtatctccaaaagcctaa

DBGET integrated database retrieval system