KEGG   Candidatus Phycorickettsia trachydisci: phytr_4060Help
Entry
phytr_4060        CDS       T05372                                 

Definition
(GenBank) glycyl-tRNA synthetase, subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ptc  Candidatus Phycorickettsia trachydisci
Pathway
ptc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ptc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    phytr_4060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptc01007]
    phytr_4060
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptc03016]
    phytr_4060
Enzymes [BR:ptc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     phytr_4060
Amino acid related enzymes [BR:ptc01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   phytr_4060
Transfer RNA biogenesis [BR:ptc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    phytr_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AVP87357
UniProt: A0A2P1P7W5
Position
complement(452834..453700)
Genome map
AA seq 288 aa AA seqDB search
MTLSFQQIISRLQEFWAKQGCVLLQGYDMEVGAGTFHPATTLKALDSKPWRAAFVQPSRR
PADSRFGDHPNRWQRYYQFQVILKPSPDNIQDLYLQSLKVLGIDYKVHDIRFVEDDWESP
TLGAWGLGWEVWCNGMEITQFTYFQGVGGLPCSSVSGEITYGLERLALYIQEKNHFKELI
WNDDPKNPMTYGDVYAANERQASDYNLYHGDIGMLLRHFDDYEEEAFKMLKVPLPLVAYE
FCLKTSHIFNLLDSRGALSTTQRAAYIARVRNIAKMCCQAYLDSQNNL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcgttccagcagattatttctcgtctgcaagagttttgggcaaagcagggt
tgcgttttattgcaaggctatgacatggaagtcggagccggtacttttcatcctgcaaca
actttaaaagctcttgattcaaaaccttggagagccgcttttgtacaaccctcaagacgt
cctgcagatagtcgttttggcgatcatccaaatagatggcagcggtattatcaatttcag
gttatacttaaaccttctccggataatatacaagatctgtatttacagagtttaaaagtt
ctgggcatagactataaagtacatgatattcgttttgttgaagatgactgggaatctccg
actctaggagcttggggccttggttgggaagtgtggtgtaatgggatggaaataacccaa
tttacgtattttcaaggcgttggaggtttgccttgtagctcagtatctggtgaaattaca
tatggattagaaaggcttgctctctacattcaggaaaaaaatcacttcaaagaattaatt
tggaatgatgaccctaagaatcctatgacatatggcgatgtttatgccgctaatgaaaga
caagcatctgactataacctttaccacggagatataggaatgctgcttcgacattttgat
gattacgaggaagaagcatttaagatgcttaaagtgccactccctttggtagcatatgaa
ttttgtcttaaaacaagtcatatttttaatttattagactcacgaggggctcttagtaca
actcaaagagcggcctatattgcccgcgtacgaaatattgctaaaatgtgctgccaggct
tatttagattcacaaaataatttatga

DBGET integrated database retrieval system