KEGG   Candidatus Phycorickettsia trachydisci: phytr_500Help
Entry
phytr_500         CDS       T05372                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ptc  Candidatus Phycorickettsia trachydisci
Pathway
ptc00450  Selenocompound metabolism
ptc00970  Aminoacyl-tRNA biosynthesis
ptc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    phytr_500
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    phytr_500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ptc01007]
    phytr_500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptc03016]
    phytr_500
Enzymes [BR:ptc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     phytr_500
Amino acid related enzymes [BR:ptc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   phytr_500
Transfer RNA biogenesis [BR:ptc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    phytr_500
 Prokaryotic type
   Other AARSs
    phytr_500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Spore_III_AB tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AVP87013
UniProt: A0A2P1P6W4
Position
complement(72160..73659)
Genome map
AA seq 499 aa AA seqDB search
MRYYVTSPIYYVNDKPHIGHAYTSIACDIIARFQRLSGKEVRFMTGTDEHGQKIQKSAQN
ADIDPQEFVDKVSENFRELANKTDISYDTFLRTTSENHKKCVKHVWSELVKGGHIYLGKY
AGWYSVRDEAFYQESELDENRLAPSGSAVEWVEEPCYFFALSKWQKPLLDFYAANPDFVK
PVSRFNEVISFVKSGLQDLAVSRKSITWGIPVPDDEEQVIYVWLDALTCYISSLGIFDKE
GSFKEFWPANVHIVGKDILRFHAVYWPAFLMALGLQPPKQIMAHGWWTNEGVKMSKSLNN
TIDPMELVKDYSTDYLRYFLFREISFGEDGNFSKESFINRVNNELNNKIGNLCQRVLSFI
FNKCEGQLQVDSVNDELFKNANELLGNMQKHMQNFALHLMLEAIINLADQSNKYMEEKAP
WTLMKSDRKAAEEALFVLVEVIRYIAISLQPFLPESANKILDQLGVPQDQRKFSCLSENF
ALRSFKINALPTPVFAKIC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgttactacgttacctcccctatttattatgtaaatgacaaacctcatataggacat
gcttatacttctatagcttgcgatattatagcaagatttcagcgccttagtggcaaggaa
gtaagattcatgaccggcactgatgagcatggtcagaaaatacaaaagtcagcacaaaat
gccgatatcgatccacaagagtttgtagataaagtgtctgaaaatttccgcgaattagca
aataagacagatatttcttatgatacctttttgcgtactacttctgaaaatcataaaaag
tgcgtaaaacacgtgtggtcagaattagtaaaaggcgggcatatttatttaggtaagtat
gcgggatggtacagcgtgcgagatgaagcattttaccaagagagtgagcttgatgaaaat
cgtttagctcctagtggatcagcagtcgagtgggtagaagagccttgttacttttttgcc
ctttcgaaatggcaaaagcctttactagacttttacgcagcaaatcctgatttcgtaaag
cctgtaagtagatttaatgaagttatatcttttgtcaaatcaggcttgcaagacttagca
gtttcgcgcaaaagcattacctggggcattccagttcctgacgatgaggagcaagtgata
tatgtatggcttgatgctttgacatgttatatatcgtctttaggcatttttgataaagag
ggtagttttaaagaattttggcccgcaaatgttcatattgtaggaaaagatattttgcgt
tttcatgctgtatattggccagcttttttgatggcattgggtcttcagcctccaaagcaa
atcatggcccacggctggtggactaatgaaggagtcaagatgtctaaatctttaaataat
accattgatccaatggaattggttaaagattacagcacagactatttacgttatttctta
ttcagagaaattagctttggtgaagatgggaatttttcaaaagaaagttttataaatcga
gttaacaacgaattaaacaacaaaattggtaacttatgtcagcgagttctaagctttata
tttaataaatgtgagggacagcttcaagtagacagcgtcaatgatgaattatttaaaaat
gcaaatgagcttttaggaaatatgcaaaagcatatgcagaattttgctctgcatttgatg
ttagaagctattattaacttagctgatcaatctaataagtacatggaagaaaaagctcct
tggactttaatgaaaagtgatagaaaagcagcagaagaggcattgtttgttttagtagag
gtaattagatatatagcaattagcctgcagccatttttgccagaatctgctaataagata
ttggatcagctaggcgtacctcaagatcaacgcaagtttagctgtttaagcgaaaatttt
gctttgagaagttttaagattaatgcccttccaacaccagtatttgctaagatatgttag

DBGET integrated database retrieval system