KEGG   Pseudoalteromonas tetraodonis: PTET_a1137Help
Entry
PTET_a1137        CDS       T05282                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine1911/1915/1917 synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ptd  Pseudoalteromonas tetraodonis
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ptd03009]
    PTET_a1137 (rluD)
Enzymes [BR:ptd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PTET_a1137 (rluD)
Ribosome biogenesis [BR:ptd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PTET_a1137 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ATD02622
UniProt: A0A1E3WSX6
Position
I:1087652..1088629
Genome map
AA seq 325 aa AA seqDB search
MSEQISLQAEVPTDLGGKRLDQVLAQLFPDYSRSRIKTWILDDKITVDGEIFNTPREKLL
GGEVVAVETTIEAPREYEAQDIKLNIVYEDDDILVINKPMGLVVHPGAGNPDGTVLNALL
HYYPEIINVPRAGIVHRLDKDTTGLMVVAKTIQAQTHLVKALQKRENFTREYEALCNGTM
TAGGMVEKPIGRHATQRTHMAVHEMGKPAITHYRVAEKFRAHTRLRLRLETGRTHQIRVH
MAYLNHPLIGDQSYGGRPRPPKGATPELFELLRSFKRQALHAVKLSIAHPITGEMMTWQA
PIPDDMVQMTQALREDTKANPDIAS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaaatatctctccaagccgaggtcccaacagacttaggtggtaaacgtcta
gaccaagtattagcacaattgttccctgattattcacgatcacggataaaaacgtggatt
ttagatgataaaatcaccgttgatggtgaaattttcaacaccccgcgtgaaaaactactc
ggtggtgaagttgtagctgttgaaacaacaatagaagcacctcgtgaatacgaagcacaa
gatatcaaattaaacatcgtttatgaagacgatgatattttagtgatcaacaaaccaatg
ggattagtggttcatcctggcgcaggtaaccctgatggtacggtgttaaatgctttatta
cactactatccggaaattattaacgtaccacgagcgggtattgtgcatcgtttagacaaa
gacacaacaggtttaatggttgttgctaaaacgattcaggcacaaacacatttagttaaa
gcactgcaaaagcgcgaaaactttacacgtgaatatgaagcgttatgtaatggcactatg
acagccggtggtatggttgaaaaaccaattggtcgtcatgctacgcagcgtacgcatatg
gcagtacatgaaatgggtaaaccagctattacgcattaccgtgttgccgaaaaattccgc
gcccatacacgtttgcgtttacgtcttgaaacagggcgtacacaccaaattcgtgtgcat
atggcatacttaaaccacccattaattggcgatcaatcttatggcggtcgtcctcgtcca
ccaaaaggggcaacgcctgagttatttgagttactgcgtagctttaaacgccaagcgctt
catgccgttaaattaagtattgcgcatccaatcaccggtgaaatgatgacctggcaagcg
cctatccctgatgatatggtccaaatgactcaagcattgcgcgaagacacaaaagcaaac
cctgatatagcgagttaa

DBGET integrated database retrieval system