KEGG   Pyrenophora teres: PTT_06505Help
Entry
PTT_06505         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pte  Pyrenophora teres
Pathway
pte00220  Arginine biosynthesis
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01230  Biosynthesis of amino acids
Module
pte_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PTT_06505
Enzymes [BR:pte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PTT_06505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N TAFA
Motif
Other DBs
NCBI-ProteinID: EFQ95501
UniProt: E3RFK4
Position
Unknown
AA seq 357 aa AA seqDB search
MPAFRPSPAALRSLRRCYSTSPATPPTSPFAPRHLLSIADLTPAELTTLVQNAHKHKTAI
KQTNEVPHSMRAALAGKTVAMTFSKRSTRTRISTEGAIAAFGGSPMFLAKDDIQLGVNES
LYDTSRVLSSMTAAIVARVGPHSDVADLAKHSSVPVINALSDLYHPLQIIADLLTICEIY
PSASSTSLGLEGLKIAWIGDANNVLFDLAIGATKLGIDIAVATPAGYEIPEAMRQVISHA
AQTSPRAGKLIETTSPEEACKNADILVTDTWVSMGQEEETAKRLKAFAGFQITSELAKRG
GAKDNWSFMHCLPRHPEEVADEVFYGPRSVVFNEAENRLWSAISVMEAFVVNKGKIQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccttccgcccctctccggcagctctgcgaagcttgcgccgctgctactcgact
tcaccagctacacctcccacatcgccctttgcgccccgacatcttctctccatagcagac
ctcacaccggccgagctcaccacactcgtccaaaatgcacacaaacacaagacggccatc
aagcagaccaatgaggtgcctcattcaatgcgcgcagccttggcgggcaagactgttgcc
atgacgtttagcaagcggagcacacgcacgaggatatcaacagagggcgccattgctgcc
tttggaggttcgcccatgtttttggccaaggacgacatacagctgggtgtcaacgagtcc
ctctacgacacctcccgagtcctctccagcatgactgctgccattgttgcccgcgtagga
ccccactcggacgttgccgacctcgcaaaacactcaagcgtgcctgtcatcaatgccctc
tccgacctctaccaccccctccagatcatcgccgacctgctcaccatctgcgaaatctac
ccctccgcctcttccacgtcgctcggcctcgagggcctcaagatcgcatggatcggagac
gcaaacaatgtgctatttgacctagccattggcgcaactaaactaggcatcgacatcgct
gtcgcgacccccgcaggctatgagatccccgaggcgatgcgccaagtcatctcccacgcc
gctcagacatcgccgcgagccggcaagctcatcgaaaccacgtcgcccgaagaagcctgc
aagaacgccgatatccttgttacagacacgtgggtttccatgggccaggaagaggagacg
gcgaagcgcctcaaggcctttgccggcttccagatcacatctgagctcgccaagcgcggt
ggtgcaaaggacaactggagctttatgcactgcctgcctcgtcacccagaggaggttgcc
gacgaggtcttctacggacccaggagtgtcgtgttcaacgaggcagagaataggctgtgg
tctgccatttccgtcatggaggcctttgtagtgaacaagggaaagattcagtga

DBGET integrated database retrieval system