KEGG   Pyrenophora teres: PTT_07637Help
Entry
PTT_07637         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
pte  Pyrenophora teres
Pathway
pte00190  Oxidative phosphorylation
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    PTT_07637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B7
Motif
Other DBs
NCBI-ProteinID: EFQ94598
UniProt: E3RI35
Position
Unknown
AA seq 94 aa AA seqDB search
MTITDTIKHAVGLDGEPRKATRQEMSAAKLPLAYRDSCAHLLIPLNRCRVEEYYLPWKCE
NERHSYEKCQYDEFKERVKKMDELRAAKNGERSN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaccattaccgacacaatcaagcatgccgtcggccttgacggcgagccgagaaaggct
acccgccaggagatgagcgctgccaaactacccctagcctaccgagacagctgcgcacat
cttcttatcccgctgaaccggtgtcgggtcgaggagtactaccttccatggaagtgcgag
aacgagcgacattcgtatgaaaagtgccaatacgacgaattcaaggagcgcgtgaagaag
atggacgagctaagagcggctaagaacggggagcgcagtaactag

DBGET integrated database retrieval system