KEGG   Pyrenophora teres: PTT_08164Help
Entry
PTT_08164         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pte  Pyrenophora teres
Pathway
pte00970  Aminoacyl-tRNA biosynthesis
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PTT_08164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pte03029]
    PTT_08164
Enzymes [BR:pte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PTT_08164
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PTT_08164
Mitochondrial biogenesis [BR:pte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PTT_08164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: EFQ94232
UniProt: E3RJ69
Position
Unknown
AA seq 403 aa AA seqDB search
MDEFGMGSHSTNSHFGPVKMIKPSGGEFSAGGSSGGSAVAVASDQVWAALGTDTGGSVRL
PAAYTGVVGFKPSYGLLSRWGVIAYANSLDTVGIIGRDTLAVRHIFRALNVEDVNDPTSL
PNALRINKKIRGAKGKSLRIGIPLDYNIDSLQPRVKELWIRSLRGMWKYGHTLHPIRLPT
TQQALSAYYVLAPAEASSNLAKYDGVRFGSRAEGTDGTRDSVLFARTRGQGFGPEVQRRI
LLGTFSLSAEAIDNYFIQAQKVRRLVQQDFNSVFATQNPLFDTKDDWDESDKVDVIVCPT
APSTAPPLSEVETQDPIQSYTNDVFTVPASLAGLPAITMPTRNNNRNEDPIGIQIIGQYG
DDELVLRAAVGFHKVERKYMKEESSTTSSTTSALSKLFNYFRG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatgagttcggcatggggtcgcactcgacaaactcgcattttggcccagttaaaatg
atcaagccgtcgggcggcgaattcagcgcaggagggagttcaggcggaagtgcagtggcc
gttgcaagtgaccaggtttgggcagcgctgggcaccgatactggaggttctgtgagactc
cctgctgcgtacacgggcgtagttggattcaagccgagttacgggctactgtccagatgg
ggcgtcattgcttacgccaactcccttgatactgtcggcatcattgggcgggatacccta
gctgtgaggcacatatttagagctctcaatgtcgaggatgtaaatgacccaacttccctg
cccaacgcattgcgtatcaacaagaagatacggggtgcaaagggtaagagtctcaggatc
ggaatccctctcgactacaacatcgatagcctacagcccagagtaaaagagctttggatt
cgttccctgaggggaatgtggaagtacggtcatacactacatcccatccgattacctacc
acacaacaagctctgtcggcctattatgtactagcgccagccgaagcctcgagcaacctc
gcaaaatacgatggagtccggttcggtagcagagcagaaggcaccgatgggacgcgtgac
agtgtcctctttgccagaacccgaggccaggggtttggcccagaagtccagcgccgcatt
cttctcggcacattttcgctcagtgccgaagcaatcgacaactactttatccaagcacaa
aaggttcgcaggctggtgcagcaggactttaacagcgtttttgcaacgcaaaaccctctt
tttgatacgaaagatgactgggacgagagtgacaaagtcgacgtcatcgtatgccccacg
gcgccctcgacggcaccaccactatcagaggtcgaaacccaagaccccatacaatcgtat
accaatgatgtcttcaccgttccagccagtcttgcaggactcccagccatcactatgccg
acacgaaacaacaacagaaatgaagacccaatcggtatacaaatcattggccagtatgga
gacgacgagctcgttctccgcgctgcggtcgggtttcataaagtcgagcgaaagtatatg
aaagaagagtcatccaccacatcatctactacatcggccttgtcaaagctattcaactat
ttcagaggctga

DBGET integrated database retrieval system